CAZyme Information: MGYG000003875_00638

Basic Information

• Species: Firm-11 sp900540045
• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; CAG-74; Firm-11; Firm-11 sp900540045
• CAZyme ID: MGYG000003875_00638
• CAZy Family: GH2
• CAZyme Description: Beta-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
936	MGYG000003875_4|CGC4	105447.98	5.736

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003875	3247365	MAG	United States	North America

• Gene Location: Start: 135019; End: 137829 Strand: +

Full Sequence      

MNQTAWSLNGVWQVVTDDELQGRALHWERHSALLNRPDVRQVSIPCCLETCVEDFEGVAW
FHRAFVHEGPTEGRCLRLRFGAVNYRAEVWLNGHPIGFHEGGYTDFAFEIGDLVVPGVEN
HLVVRVITPLITRREPIDGLGYNEMPHWRGAITGGIWQDVTLLETGPLYLDHPFACPDLA
QSRAIIRLSAHNTLLRHADALLKTTVCQEDDGMVVFEDRRELRLRPGTVDVEVEAPIPSP
RLWSPDAPHLYRVRLKLLAQGQTQDEQSFVFGMREFTARGRDFYLNGEKLLIKAAFYEGY
YPGTLAFPEKPELIEKEIRLAKEAGLNLLRPWRKPQPPIVYELADRMGMLMVGAIAVECM
RFWPQLSPAMAARIEQDLREMVLRDRNHPCIVMWEVFNEVHRQELKRLRHPMALAARSLD
ESRMILDESGGFYDGASVYLPGEWSPTVIADVHFYPGAPVNNHTYAELYCLGRSREEMAR
IGLTKGSNTESRVVPDTLTNVTELGYGSSPDLPAVMATYARGCNPLTPDYKIHRRLYDTY
RQVLRDTGVMDDFGSLEAWCQAEQQRHAAANKDMLEACRVNPRVAGIGIHAFVDGDWVVG
AGMLDIHRRPKAAYYVMKQAFAPAFASARPDRPNCYPGQAPVLACHVASDADALSAPFVL
DILDEGGSRVFHSEQEAQAECTAVRLEDLCPGPLPEGRYRVTVAWGPARNETSFWVLRPV
CDVKGPLHLYDTCGVLRSLLDRYCVPWREAGEDSRVIYVLGDLTPADGARLETMARAGAT
VAVLDLPQGVKRVVNEMELADGLLPFPLRTCESFGYWTPNNHVARRGHPLFRHLPTGMMD
ETYQNVCPRRSVRHQGHDWALGMIGYGWWQDQMDLQNYTGVSGAFDAADVFFRRWGGGRY
LLSTLRLRDSLGEDPVADQLFFNLAAWLEGEAGNED

Enzyme Prediction     

No EC number prediction in MGYG000003875_00638.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	6	626	5.7e-88	0.613031914893617

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	1.02e-38	63	434	70	438	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
PRK10150	PRK10150	1.48e-32	7	423	14	443	beta-D-glucuronidase; Provisional
PRK10340	ebgA	1.19e-26	78	425	130	472	cryptic beta-D-galactosidase subunit alpha; Reviewed
PRK09525	lacZ	5.21e-23	77	399	141	462	beta-galactosidase.
pfam02836	Glyco_hydro_2_C	2.81e-13	279	431	4	164	Glycosyl hydrolases family 2, TIM barrel domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOR25451.1	2.59e-168	7	927	46	987
QWG09357.1	2.26e-165	7	926	31	971
AZQ64977.1	1.45e-162	7	924	31	969
ANQ51452.1	1.16e-159	7	924	27	965
QBY04221.1	7.25e-159	2	928	33	977

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6ED1_A	9.69e-34	57	424	77	448	ChainA, Glycosyl hydrolase family 2, sugar binding domain protein [Phocaeicola dorei],6ED1_B Chain B, Glycosyl hydrolase family 2, sugar binding domain protein [Phocaeicola dorei],6ED1_C Chain C, Glycosyl hydrolase family 2, sugar binding domain protein [Phocaeicola dorei],6ED1_D Chain D, Glycosyl hydrolase family 2, sugar binding domain protein [Phocaeicola dorei]
7RSK_A	2.96e-29	57	404	71	410	ChainA, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7RSK_B Chain B, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838]
4YPJ_A	5.61e-29	57	401	70	412	ChainA, Beta galactosidase [Niallia circulans],4YPJ_B Chain B, Beta galactosidase [Niallia circulans]
7CWD_A	9.90e-29	57	401	64	406	ChainA, beta-glalactosidase [Niallia circulans],7CWI_A Chain A, beta-galactosidase [Niallia circulans]
6B6L_A	4.77e-28	57	404	71	410	Thecrystal structure of glycosyl hydrolase family 2 (GH2) member from Bacteroides cellulosilyticus DSM 14838 [Bacteroides cellulosilyticus DSM 14838],6B6L_B The crystal structure of glycosyl hydrolase family 2 (GH2) member from Bacteroides cellulosilyticus DSM 14838 [Bacteroides cellulosilyticus DSM 14838]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A7LXS9	2.45e-31	57	427	102	460	Beta-galactosidase BoGH2A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02645 PE=1 SV=1
T2KM09	2.32e-30	57	430	106	459	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22050 PE=2 SV=2
P77989	1.17e-29	53	396	52	384	Beta-galactosidase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) OX=340099 GN=lacZ PE=3 SV=2
Q6D736	9.73e-25	77	399	149	472	Beta-galactosidase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) OX=218491 GN=lacZ PE=3 SV=1
B2VHN8	1.97e-23	64	437	134	498	Beta-galactosidase OS=Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99) OX=465817 GN=lacZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000039	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003875_00638.