CAZyme Information: MGYG000003874_00374

Basic Information

• Species: Merdibacter sp900759455
• Lineage: Bacteria; Firmicutes; Bacilli; Erysipelotrichales; Erysipelotrichaceae; Merdibacter; Merdibacter sp900759455
• CAZyme ID: MGYG000003874_00374
• CAZy Family: GH123
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1119		127712.69	4.3355

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003874	1971751	MAG	United States	North America

• Gene Location: Start: 497; End: 3856 Strand: +

Full Sequence      

MLEFKEHTVEVTNVKEENQSQLAIQIEYVKIFRELNNSDCYKEINVESNDITTTNEINKI
QYSENHNWAEGIGSIEDYSGGNDYWTSTKGAYYTIKFKGRSIKILGKKASDFGQYDVYMD
DEKIDTIQAQNNDKLLKQVLFEKSFDQTEEHVFKVIKEGNGVIEVDNIIVGTDEYIAVDE
IQVYPNNVEIGVNQTQKIFPTILPNDSTTNTVQFRSLNSNIAKVNMDGVVKGVSVGKTEI
EVICGGLVTKVPVNVKQEKDIMGTSFAYTGTHTLDQDYQKTKLLNDKNENLVAWKNDEVH
AKAIIWSYDQPLNNIKVSSSDLVGEQGSIKKEFIDVNFLTEVSAYVGKGNAANKPHENIP
EVIDYKDSVNLDPESSIGAWLSINTPTDVKAGIYNGTLTITSDEKTEELKYSLEILDIVY
PETKDYTMLELWQYPFSAARYYESVGKNNYFSDQHINILKEQLQLYANAGGTAITTSILE
EPWGHQTYDDYPSMVRWKKTESGVFDFDYTWFDKYVELCMELGIDKQIKSFSMVPWSNKI
VYFDEKSNQNKNIQIFKTENGSWTGQMTDEGKAAWDTFLDSYIKHLDEKGWFDITYIAMD
ERPMQSMETAIQLIKSHKNKDGKSLKISGCFNHYGSGAYEEILENTDDVSIGMTAINGEE
GMEQFRKWALDRKEKGLLTSIYTCTTHYPNSFTRSNPDEAEWVLWFVESMNADGFLRWAY
DAFLKDPYDNIDAGYEAGDEFFIYPDPDQSSENPVTRSTVRFEMMEEGIHNIVKYRYLME
NADEKIVKKLKSGVTEFQRIKGTTVEGGAEGTTESKSEVTAQVKEMDETLSECTQLYIIQ
RNVEISREELRKELENAEILLEQAIEGEQPGNYPKEAILTFEEVLVKIKEEMNEVLSLNE
IKSLKNELKIAETNFKNSVVVVHKNLLEMTIQKAESLVKSEYTVESWKRLEIALSDAVEV
YRDDNATQEIVDNAKEALDDAILSLKKVDVPDQVNKLALYELLKTYEGYHSSDYTESSWK
LFKEAYDGAYKVYLDENATQEEVTEAYELLQKAALNLKNAIDNPNEDATEGEPIQQPDKD
TTDTAASGLNTLPWTAAGILSLMSMYMIYRKKEKNDNDF

Enzyme Prediction     

No EC number prediction in MGYG000003874_00374.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH123	266	799	5.3e-140	0.9442379182156134

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam13320	DUF4091	1.07e-15	711	779	1	66	Domain of unknown function (DUF4091). This presumed domain is functionally uncharacterized. This domain family is found in bacteria, archaea and eukaryotes, and is approximately 70 amino acids in length. There is a single completely conserved residue G that may be functionally important.
pfam02368	Big_2	1.35e-07	181	255	3	77	Bacterial Ig-like domain (group 2). This family consists of bacterial domains with an Ig-like fold. Members of this family are found in bacterial and phage surface proteins such as intimins.
smart00635	BID_2	7.56e-07	177	253	1	80	Bacterial Ig-like domain 2.
COG5492	YjdB	0.006	81	255	82	263	Uncharacterized conserved protein YjdB, contains Ig-like domain [General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AYE33261.1	3.40e-148	42	845	40	848
QAS61432.1	3.40e-148	42	845	40	848
QUD71731.1	1.29e-141	22	845	175	1002
QIK86567.1	6.22e-140	68	961	56	961
QBJ76609.1	2.39e-136	259	838	3	580

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5FQE_A	6.92e-126	246	836	13	591	Thedetails of glycolipid glycan hydrolysis by the structural analysis of a family 123 glycoside hydrolase from Clostridium perfringens [Clostridium perfringens],5FQE_B The details of glycolipid glycan hydrolysis by the structural analysis of a family 123 glycoside hydrolase from Clostridium perfringens [Clostridium perfringens],5FQF_A The details of glycolipid glycan hydrolysis by the structural analysis of a family 123 glycoside hydrolase from Clostridium perfringens [Clostridium perfringens],5FQF_B The details of glycolipid glycan hydrolysis by the structural analysis of a family 123 glycoside hydrolase from Clostridium perfringens [Clostridium perfringens],5FR0_A The details of glycolipid glycan hydrolysis by the structural analysis of a family 123 glycoside hydrolase from Clostridium perfringens [Clostridium perfringens]
5FQG_A	1.01e-124	246	836	13	591	Thedetails of glycolipid glycan hydrolysis by the structural analysis of a family 123 glycoside hydrolase from Clostridium perfringens [Clostridium perfringens],5FQH_A The details of glycolipid glycan hydrolysis by the structural analysis of a family 123 glycoside hydrolase from Clostridium perfringens [Clostridium perfringens]
5L7V_A	5.37e-93	287	785	50	523	ChainA, glycoside hydrolase [Phocaeicola vulgatus ATCC 8482],5L7V_B Chain B, glycoside hydrolase [Phocaeicola vulgatus ATCC 8482]
5L7R_A	8.06e-93	287	785	65	538	ChainA, glycoside hydrolase [Phocaeicola vulgatus ATCC 8482],5L7R_B Chain B, glycoside hydrolase [Phocaeicola vulgatus ATCC 8482],5L7U_A Chain A, Glycoside hydrolase [Phocaeicola vulgatus ATCC 8482],5L7U_B Chain B, Glycoside hydrolase [Phocaeicola vulgatus ATCC 8482]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000028	0.000003	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003874_00374.