CAZyme Information: MGYG000003872_02130

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; Clostridium_A
• CAZyme ID: MGYG000003872_02130
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
887	MGYG000003872_38|CGC1	98684.24	5.3677

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003872	2901403	MAG	United States	North America

• Gene Location: Start: 20519; End: 23182 Strand: +

Full Sequence      

MSHCFQVYGLTCGHVTNPLAIEQDAVSFGWKASHPIPGALQKSYRIQVFQGNDNSTPVWD
SGTILSRACYGIPYEGPALAEGQDYRWTVVVQDEFGVFCESSPASFSIGISQWDGCWLAG
ANYMAGDTAPLFRKEFSAPADLVSAKLYLAAVGYAEVTLNGRRISDRVLEPGWTDFRKTV
LYSAYDVSKLLRAGENAVGVMMGSGWYSNGNLCYDTASMGGQFLLQLVMVRTNGERITVS
SGLHQGWLTTSKGPVRRESVYHGETYDARMEKPGWSQPGYLPGPEDGWQEPLWAEPPEGR
LRPQVMEPIRVRKALEPVEIHQTGPDEYVFDFGQNLAGWARLKVQGQRGQKVELKFAENV
YPDGSIDVTTTRNALAQDEYILKGQGVEQYEPQFTYHGFRYVRMRGYPGIPGPDALKACL
VCSDVASRGQFSCGSEILNRIHQAALWTELSNLHSIPTDCPQRDERLGWLNDMTVRAEEA
VYNFNMSAFYEKWTDDILDGQGPVTGALPDVAPFFRLGRRPADPVSSCLLVVPWLVYLHT
GDKRILDKCYDGMKRWEAYLERVSDQDIVKFSYFGDWAGPVTASDPESGASGSYSAVTPP
DFISTWAYYLNCVLLENIARVLGKGEDADAYQAMKGRILNRFNQKFFHDNENQYAAGSQA
SNVCGLLLNMVPSGKSDQVLANLVHDIKERQGTHLTTGNQCTKYVMDVLTLYGHIDTAFA
LASQTSYPSWGYMLENGGTTIWERWEKASTGLVTECCSQSHPMNASIDAWFYKYLIGIQP
DPSAPGFENILIRPRIPQNLSSASGVLETVRGPIASCWSQNSRRLTLKIEIPFNSTGDVT
LETSGFCRIVRDGQVLWQKQDSSPMSQQSITLRVFPGKHSFVCEKDV

Enzyme Prediction     

No EC number prediction in MGYG000003872_02130.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	320	841	3.6e-155	0.998015873015873
CBM67	125	280	2.8e-26	0.8238636363636364

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	7.45e-99	429	775	4	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam08531	Bac_rhamnosid_N	1.04e-49	140	313	1	172	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
pfam05592	Bac_rhamnosid	2.26e-37	322	421	2	101	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	2.77e-13	777	841	1	63	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEF82974.1	1.72e-228	10	852	16	852
QGA22854.1	1.86e-212	6	854	33	864
AHF90970.1	3.35e-211	12	853	13	856
QEC51112.1	1.27e-200	17	854	81	908
AEE96386.1	2.79e-200	10	885	13	890

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6I60_A	4.87e-198	2	885	27	943	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]
3W5M_A	1.58e-121	98	839	273	992	CrystalStructure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]
6GSZ_A	5.28e-110	132	845	134	850	Crystalstructure of native alfa-L-rhamnosidase from Aspergillus terreus [Aspergillus terreus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q82PP4	6.61e-121	98	839	273	992	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1
T2KNB2	9.95e-121	17	881	46	920	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22090 PE=1 SV=2
P9WF03	1.39e-116	17	838	42	875	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1
T2KPL4	5.43e-116	16	873	41	934	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999999	0.000056	0.000001	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003872_02130.