CAZyme Information: MGYG000003868_00889

Basic Information

• Species: Phascolarctobacterium sp900545535
• Lineage: Bacteria; Firmicutes_C; Negativicutes; Acidaminococcales; Acidaminococcaceae; Phascolarctobacterium; Phascolarctobacterium sp900545535
• CAZyme ID: MGYG000003868_00889
• CAZy Family: GT83
• CAZyme Description: Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
516	MGYG000003868_6|CGC2	59279.44	8.8779

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003868	2553728	MAG	United States	North America

• Gene Location: Start: 67583; End: 69133 Strand: -

Full Sequence      

MNRIEKGSLLVLAIIVAFNIFFGLGSIPLLDPDEPVYAETAREMIQFNDYLSPRIYNEYW
FDKPPMYYWLVAGSMHVFGDSEFAARFPAAVMAFLTVIMLYCSVTRLFNEKAGFWSALVL
ATSVQFFYLGKAAVTDTTLLFFLTGALLCYLHKKYWLMYVCMALATVTKGPIGIVFPGAI
IFLHILCTGQWRLILKMHCVRGLLLYFLIAAPWYYLMYQVHGMEFIDTFLGFHNLTRFTT
PEHPTRVLWWYYFPVIVLGLFPWTGLLLQSVKASIADSRSDDLGKMLFVNIWWIFVLIFF
TVSKTKLVSYILPMFPALAIMIGWNIARMQKENYGIRWSWILGSGIMFLLLTVGWVIGGQ
QLPEVAFGGIVLGVVTFILGLSIIWALWYYRDISFAAWLHVVTGVLTMVIAFSFLLPMVA
NRFSVKEIAKVYQARCDQQKPVYVDKFLRPGFMYYTGEPGLEVRPKSNDLAAALNAPETK
YILVRGLELRRLKDQNKLQHLNEITELGDIYLLEKY

Enzyme Prediction     

No EC number prediction in MGYG000003868_00889.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT83	4	497	5.6e-123	0.9425925925925925

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1807	ArnT	1.93e-63	3	431	4	446	4-amino-4-deoxy-L-arabinose transferase or related glycosyltransferase of PMT family [Cell wall/membrane/envelope biogenesis].
PRK13279	arnT	2.05e-35	1	387	2	397	lipid IV(A) 4-amino-4-deoxy-L-arabinosyltransferase.
pfam13231	PMT_2	1.87e-21	62	215	1	159	Dolichyl-phosphate-mannose-protein mannosyltransferase. This family contains members that are not captured by pfam02366.
pfam02366	PMT	1.18e-06	59	219	58	236	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.
COG1287	Stt3	0.001	62	423	86	415	Asparagine N-glycosylation enzyme, membrane subunit Stt3 [Posttranslational modification, protein turnover, chaperones].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QTV77242.1	3.60e-252	1	515	1	518
AOH48432.1	3.00e-175	10	495	13	505
QNH53437.1	4.24e-175	10	495	13	505
ANR70824.1	9.05e-172	10	492	13	502
AME03144.1	2.08e-170	10	491	13	501

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5EZM_A	1.49e-36	11	335	35	373	CrystalStructure of ArnT from Cupriavidus metallidurans in the apo state [Cupriavidus metallidurans CH34],5F15_A Crystal Structure of ArnT from Cupriavidus metallidurans bound to Undecaprenyl phosphate [Cupriavidus metallidurans CH34]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O67601	1.23e-36	6	351	2	327	Uncharacterized protein aq_1704 OS=Aquifex aeolicus (strain VF5) OX=224324 GN=aq_1704 PE=3 SV=1
O67270	2.04e-32	5	321	3	316	Uncharacterized protein aq_1220 OS=Aquifex aeolicus (strain VF5) OX=224324 GN=aq_1220 PE=3 SV=1
Q7N3Q9	3.54e-32	2	321	4	331	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01) OX=243265 GN=arnT PE=2 SV=1
A0KGY4	1.08e-29	28	333	24	337	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049) OX=380703 GN=arnT PE=3 SV=1
C5BDQ8	1.12e-29	29	377	27	391	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Edwardsiella ictaluri (strain 93-146) OX=634503 GN=arnT PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000012	0.000006	0.000001	0.000000	0.000000	0.000002

TMHMM  Annotations     

start	end
7	29
83	105
112	129
134	151
172	194
204	226
247	268
283	300
307	326
336	358
365	387
397	419