CAZyme Information: MGYG000003863_01059

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; Hydrogeniiclostridium
• CAZyme ID: MGYG000003863_01059
• CAZy Family: GH0
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
606	MGYG000003863_107|CGC1	70039.67	4.829

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003863	2725478	MAG	United States	North America

• Gene Location: Start: 563; End: 2383 Strand: +

Full Sequence      

MTRFEKMKRDYMTGWKTWNNESVLSYVWMPEGIGISLGMKDYQYEKILDTALIGQSEEEG
VVTPYAHAYDTSYTELKLDWLQNTIRVATALDGEDLVVLVTPERRPFKSSSLIISGGSFW
NKGGTVERDEDVLLLKSGEKSIPVYMTSPHTNELFVRCTNPYLSTELSEAVGISTGRKRS
LQEICNIIEHQKKNWQKHKETYGELSEAYNAMQTCLAWDTIYNPQDDTPITTVSRLWNRR
WGGYVLFCWDTYFGALTLSMGAKELAYCNAVAITRTHTKDGFVPNFACQNGFKSYDRSQP
PVGSMACLMLYKHYGDTWFLEEVYSDLVRWNQWFFENRSTKNGLLAWGSGTYEPITGHAL
ELYDVHDRQGAAYESGLDNSPMYDDTPFDEERGILLLEDVGLTGLYIEDCRCLAEIASVL
GDTQKARELSRRREKLEEAMEQLWDEDFGMYLNRREDTGDFEYRLSPFHFHALFSSKVSE
EHVERILKEHFYNPNEFWGDFILPSIARNDPAFPEQTYWRGRIWAPMNFLVYMALRCHGC
GEARKDLSEKSVKLILQEWLEKGHVHENYDPNTGEGCNSDRSDRFYHWGGLLSFIALLEN
GYYSGM

Enzyme Prediction     

No EC number prediction in MGYG000003863_01059.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam03200	Glyco_hydro_63	1.12e-16	319	595	187	491	Glycosyl hydrolase family 63 C-terminal domain. This is a family of eukaryotic enzymes belonging to glycosyl hydrolase family 63. They catalyze the specific cleavage of the non-reducing terminal glucose residue from Glc(3)Man(9)GlcNAc(2). Mannosyl oligosaccharide glucosidase EC:3.2.1.106 is the first enzyme in the N-linked oligosaccharide processing pathway. This family represents the C-terminal catalytic domain.
PRK10137	PRK10137	2.99e-16	281	575	391	762	alpha-glucosidase; Provisional
COG3408	GDB1	8.98e-08	244	577	282	589	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].
pfam01204	Trehalase	1.46e-07	249	570	131	474	Trehalase. Trehalase (EC:3.2.1.28) is known to recycle trehalose to glucose. Trehalose is a physiological hallmark of heat-shock response in yeast and protects of proteins and membranes against a variety of stresses. This family is found in conjunction with pfam07492 in fungi.
PLN02567	PLN02567	1.99e-07	249	570	156	511	alpha,alpha-trehalase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNK58860.1	2.40e-205	1	602	15	617
QTH44429.1	8.64e-203	2	602	15	616
QNI32096.1	4.32e-181	7	599	1	600
QLE02613.1	3.53e-173	5	602	32	622
QRQ47302.1	2.66e-166	4	601	31	630

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3W7S_A	6.42e-10	223	574	296	734	Escherichiacoli K12 YgjK complexed with glucose [Escherichia coli K-12],3W7S_B Escherichia coli K12 YgjK complexed with glucose [Escherichia coli K-12],3W7T_A Escherichia coli K12 YgjK complexed with mannose [Escherichia coli K-12],3W7T_B Escherichia coli K12 YgjK complexed with mannose [Escherichia coli K-12],3W7U_A Escherichia coli K12 YgjK complexed with galactose [Escherichia coli K-12],3W7U_B Escherichia coli K12 YgjK complexed with galactose [Escherichia coli K-12]
7T66_A	2.00e-09	319	602	535	814	ChainA, Chaetomium alpha glucosidase [Thermochaetoides thermophila DSM 1495],7T66_B Chain B, Chaetomium alpha glucosidase [Thermochaetoides thermophila DSM 1495],7T68_A Chain A, Chaetomium alpha glucosidase [Thermochaetoides thermophila DSM 1495],7T68_B Chain B, Chaetomium alpha glucosidase [Thermochaetoides thermophila DSM 1495],7T6W_A Chain A, Chaetomium alpha glucosidase [Thermochaetoides thermophila DSM 1495],7T6W_B Chain B, Chaetomium alpha glucosidase [Thermochaetoides thermophila DSM 1495],7T8V_A Chain A, Chaetomium alpha glucosidase [Thermochaetoides thermophila DSM 1495],7T8V_B Chain B, Chaetomium alpha glucosidase [Thermochaetoides thermophila DSM 1495]
3W7X_A	2.55e-09	223	574	296	734	Crystalstructure of E. coli YgjK D324N complexed with melibiose [Escherichia coli K-12],3W7X_B Crystal structure of E. coli YgjK D324N complexed with melibiose [Escherichia coli K-12],5CA3_A Crystal structure of the glycosynthase mutant D324N of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12],5CA3_B Crystal structure of the glycosynthase mutant D324N of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12]
3W7W_A	3.36e-09	223	574	296	734	Crystalstructure of E. coli YgjK E727A complexed with 2-O-alpha-D-glucopyranosyl-alpha-D-galactopyranose [Escherichia coli K-12],3W7W_B Crystal structure of E. coli YgjK E727A complexed with 2-O-alpha-D-glucopyranosyl-alpha-D-galactopyranose [Escherichia coli K-12],5GW7_A Crystal structure of the glycosynthase mutant E727A of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12],5GW7_B Crystal structure of the glycosynthase mutant E727A of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12]
3D3I_A	6.95e-08	223	574	297	735	Crystalstructural of Escherichia coli K12 YgjK, a glucosidase belonging to glycoside hydrolase family 63 [Escherichia coli K-12],3D3I_B Crystal structural of Escherichia coli K12 YgjK, a glucosidase belonging to glycoside hydrolase family 63 [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P42592	3.57e-09	223	574	319	757	Glucosidase YgjK OS=Escherichia coli (strain K12) OX=83333 GN=ygjK PE=1 SV=1
Q19426	8.84e-07	493	595	675	789	Mannosyl-oligosaccharide glucosidase OS=Caenorhabditis elegans OX=6239 GN=mogs-1 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000063	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003863_01059.