CAZyme Information: MGYG000003859_00936

Basic Information

• Species: 51-20 sp001917175
• Lineage: Bacteria; Proteobacteria; Alphaproteobacteria; RF32; CAG-239; 51-20; 51-20 sp001917175
• CAZyme ID: MGYG000003859_00936
• CAZy Family: GT2
• CAZyme Description: Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
355	MGYG000003859_17|CGC1	40879.31	8.6788

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003859	1621181	MAG	United States	North America

• Gene Location: Start: 21021; End: 22088 Strand: -

Full Sequence      

MAEISVIIPVYNAEKYIAGCLDALCAQTFGDIEVLCVDDGSTDGSGSILAEYAGKDPRIR
VFSQANAGPAVARNLGLKNAGGRYVMFCDADDSYRPDCCERMLRTMTEKRPDVAVCRCRV
EIEEVDTKARQHTVSESFYNAPYTGMHVLDDELRVKMSVVLWNKIFAKELIERYGICFPE
GCEHDDDTFWMLYSLFAKDVYFLSERLYNYRIRVNSIMSNYFNKKPKNKYDRYRVCNFVY
DFLQRKGLLEANLAAVSDFYRRQTGMMFFDLFTADELRKMTDEMNARQLDCLFAVRRGKI
FSAPRAGLEEAGWGKLLKYMLLSGITVGRRKKMLKKEEKTVRSQLRMKKILKKAG

Enzyme Prediction     

No EC number prediction in MGYG000003859_00936.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	5	141	1.7e-40	0.8117647058823529

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK10073	PRK10073	1.17e-42	3	217	7	222	putative glycosyl transferase; Provisional
pfam00535	Glycos_transf_2	1.65e-41	5	140	1	137	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
cd00761	Glyco_tranf_GTA_type	1.17e-37	6	116	1	112	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.
cd02525	Succinoglycan_BP_ExoA	4.95e-29	4	116	2	114	ExoA is involved in the biosynthesis of succinoglycan. Succinoglycan Biosynthesis Protein ExoA catalyzes the formation of a beta-1,3 linkage of the second sugar (glucose) of the succinoglycan with the galactose on the lipid carrie. Succinoglycan is an acidic exopolysaccharide that is important for invasion of the nodules. Succinoglycan is a high-molecular-weight polymer composed of repeating octasaccharide units. These units are synthesized on membrane-bound isoprenoid lipid carriers, beginning with galactose followed by seven glucose molecules, and modified by the addition of acetate, succinate, and pyruvate. ExoA is a membrane protein with a transmembrance domain at c-terminus.
COG0463	WcaA	4.07e-28	1	268	2	254	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QYN43933.1	4.08e-48	4	230	8	230
QYN46433.1	6.30e-48	4	218	7	217
SEH98508.1	3.51e-47	4	219	7	221
QRQ82122.1	3.32e-44	1	227	9	231
QIM15890.1	2.69e-42	2	248	329	576

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5HEA_A	1.43e-34	4	213	7	218	CgTstructure in hexamer [Streptococcus parasanguinis FW213],5HEA_B CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEA_C CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEC_A CgT structure in dimer [Streptococcus parasanguinis FW213],5HEC_B CgT structure in dimer [Streptococcus parasanguinis FW213]
3BCV_A	7.98e-22	3	92	6	95	Crystalstructure of a putative glycosyltransferase from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3BCV_B Crystal structure of a putative glycosyltransferase from Bacteroides fragilis [Bacteroides fragilis NCTC 9343]
5TZE_C	1.01e-16	3	210	2	202	Crystalstructure of S. aureus TarS in complex with UDP-GlcNAc [Staphylococcus aureus],5TZE_E Crystal structure of S. aureus TarS in complex with UDP-GlcNAc [Staphylococcus aureus],5TZI_C Crystal structure of S. aureus TarS 1-349 [Staphylococcus aureus],5TZJ_A Crystal structure of S. aureus TarS 1-349 in complex with UDP-GlcNAc [Staphylococcus aureus],5TZJ_C Crystal structure of S. aureus TarS 1-349 in complex with UDP-GlcNAc [Staphylococcus aureus],5TZK_C Crystal structure of S. aureus TarS 1-349 in complex with UDP [Staphylococcus aureus]
5TZ8_A	2.02e-16	3	210	2	202	Crystalstructure of S. aureus TarS [Staphylococcus aureus],5TZ8_B Crystal structure of S. aureus TarS [Staphylococcus aureus],5TZ8_C Crystal structure of S. aureus TarS [Staphylococcus aureus]
2Z87_A	2.15e-16	4	142	376	508	Crystalstructure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GalNAc and UDP [Escherichia coli],2Z87_B Crystal structure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GalNAc and UDP [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P71057	3.86e-37	4	224	6	225	Putative glycosyltransferase EpsH OS=Bacillus subtilis (strain 168) OX=224308 GN=epsH PE=2 SV=1
A0A0H2URH7	5.49e-32	3	217	6	222	Glycosyltransferase GlyA OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=glyA PE=3 SV=1
P71059	2.85e-28	4	217	5	218	Uncharacterized glycosyltransferase EpsJ OS=Bacillus subtilis (strain 168) OX=224308 GN=epsJ PE=2 SV=1
P11290	7.29e-27	3	235	7	240	Uncharacterized glycosyltransferase YibD OS=Escherichia coli (strain K12) OX=83333 GN=yibD PE=3 SV=2
A0A0H2UR96	1.25e-26	4	223	5	227	Glycosyltransferase GlyG OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=glyG PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000072	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003859_00936.