CAZyme Information: MGYG000003858_01559

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; UMGS363
• CAZyme ID: MGYG000003858_01559
• CAZy Family: GH5
• CAZyme Description: Endoglucanase C

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
318		36455.84	4.5367

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003858	2536747	MAG	United States	North America

• Gene Location: Start: 576; End: 1532 Strand: -

Full Sequence      

MTGFKGYKKGVDFGGWLSQCVHTKEHYDTFISEEDVKTAASWGIDHIRLPIDYNLLEDEN
GSPIDNGFGYIDNAVKWCKAAGLNIILDLHKTAGYSFDKGEGEFGFFDSEPLQERFMKLW
DRIAERYAVSDGTIAFELLNEVTDQSFSEKWNRLIRSTIERIRKIAPDTYILVGGYWNNS
PDAVPDLDAPYDDKVIYNFHCYDPLNFTHQGAYWVDGMDTSFRMKIEDSEPAITPEYFIG
RFDRAYEAAKANGTILYCGEYGVIDLASPEDTVKWFKAIHEAFERLGIGRAAWNYKKMDF
GISDTRLDGVRDELIKYL

Enzyme Prediction     

EC	3.2.1.4	3.2.1.-	3.2.1.74

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	10	300	6e-122	0.9968051118210862

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00150	Cellulase	3.68e-34	2	295	4	268	Cellulase (glycosyl hydrolase family 5).
COG2730	BglC	1.04e-27	5	304	49	368	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUA54630.1	6.79e-140	6	318	5	316
QTE72806.1	2.60e-137	6	318	5	316
QTE75915.1	2.60e-137	6	318	5	316
AHF25090.1	6.68e-137	6	318	22	333
AHF24623.1	3.23e-136	6	318	7	318

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1CEC_A	1.67e-71	7	318	4	338	ChainA, ENDOGLUCANASE CELC [Acetivibrio thermocellus]
1CEN_A	4.72e-71	7	318	4	338	ChainA, CELLULASE CELC [Acetivibrio thermocellus],1CEO_A Chain A, CELLULASE CELC [Acetivibrio thermocellus]
6UJE_A	3.02e-31	34	312	38	301	ChainA, Endoglucanase [Clostridioides difficile],6UJF_A Chain A, Endoglucanase [Clostridioides difficile]
7EC9_A	1.20e-29	33	313	39	323	ChainA, Endoglucanase [Thermotoga maritima MSB8],7EC9_B Chain B, Endoglucanase [Thermotoga maritima MSB8],7EFZ_A Chain A, Endoglucanase [Thermotoga maritima MSB8],7EFZ_B Chain B, Endoglucanase [Thermotoga maritima MSB8]
3AMC_A	2.91e-29	9	305	14	297	Crystalstructures of Thermotoga maritima Cel5A, apo form and dimer/au [Thermotoga maritima MSB8],3AMC_B Crystal structures of Thermotoga maritima Cel5A, apo form and dimer/au [Thermotoga maritima MSB8],3AMD_A Crystal structures of Thermotoga maritima Cel5A, apo form and tetramer/au [Thermotoga maritima MSB8],3AMD_B Crystal structures of Thermotoga maritima Cel5A, apo form and tetramer/au [Thermotoga maritima MSB8],3AMD_C Crystal structures of Thermotoga maritima Cel5A, apo form and tetramer/au [Thermotoga maritima MSB8],3AMD_D Crystal structures of Thermotoga maritima Cel5A, apo form and tetramer/au [Thermotoga maritima MSB8],3MMU_A Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_B Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_C Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_D Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_E Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_F Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_G Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_H Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMW_A Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMW_B Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMW_C Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMW_D Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P16169	9.25e-112	5	290	5	288	Cellodextrinase A OS=Ruminococcus flavefaciens OX=1265 GN=celA PE=3 SV=3
P23340	1.29e-70	7	318	4	338	Endoglucanase C307 OS=Clostridium sp. (strain F1) OX=1508 GN=celC307 PE=1 SV=1
A3DJ77	1.29e-70	7	318	4	338	Endoglucanase C OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=celC PE=3 SV=1
P0C2S3	1.29e-70	7	318	4	338	Endoglucanase C OS=Acetivibrio thermocellus OX=1515 GN=celC PE=1 SV=1
P25472	7.17e-22	34	294	63	298	Endoglucanase D OS=Ruminiclostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) OX=394503 GN=celCCD PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000042	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003858_01559.