CAZyme Information: MGYG000003858_00859

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; UMGS363
• CAZyme ID: MGYG000003858_00859
• CAZy Family: GH26
• CAZyme Description: Mannan endo-1,4-beta-mannosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
339		38868.76	5.3142

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003858	2536747	MAG	United States	North America

• Gene Location: Start: 13957; End: 14976 Strand: +

Full Sequence      

MKKFISIVCAVSIAFSMTACAAKNDVAIRSEATTAASSAKTDKLTLSNPDATKEAVKLFD
YINSIYGKNILSGQQESTWMGSDRYEFDYIEKNTGKLPAIRGLDYMNDDFDGVNKRAKAW
HDKGGIVTICWHCGSDFSGSWSESMKTEIKDWDKALTKGTPEYEKLIKGMDKGAEALNKL
KDQNIPVLWRPFHEFDGAWFWWGKGGSENFKKLWQLMYDRYTNYWELDNLIWVLGYSGNG
RDYDKWYPGDEYVDIAGADSYNDGANEKLYEKTVKVVGEKRPVAFHECGKIPTVDELKKA
NAKWVWFMTWHTEYITDHNDTKTLKDIYNSDYVITLDEL

Enzyme Prediction     

No EC number prediction in MGYG000003858_00859.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH26	47	338	2.8e-96	0.9966996699669967

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam02156	Glyco_hydro_26	1.85e-58	48	338	2	311	Glycosyl hydrolase family 26.
COG4124	ManB2	1.60e-18	140	289	139	296	Beta-mannanase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADU20874.1	5.84e-129	46	339	167	459
BCN30282.1	4.91e-120	43	339	3	296
AOW25662.1	9.17e-84	46	339	1	294
AWB26443.1	1.21e-83	45	339	47	336
AJP70762.1	2.28e-83	46	339	22	318

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6Q75_A	2.11e-63	48	339	25	327	Thestructure of GH26A from Muricauda sp. MAR_2010_75 [Muricauda sp. MAR_2010_75],6Q75_B The structure of GH26A from Muricauda sp. MAR_2010_75 [Muricauda sp. MAR_2010_75]
3ZM8_A	1.44e-62	46	339	145	447	ChainA, Gh26 Endo-beta-1,4-mannanase [Podospora anserina S mat+]
6HF2_A	6.78e-53	43	330	42	330	Thestructure of BoMan26B, a GH26 beta-mannanase from Bacteroides ovatus [Bacteroides ovatus ATCC 8483],6HF4_A The structure of BoMan26B, a GH26 beta-mannanase from Bacteroides ovatus, complexed with G1M4 [Bacteroides ovatus ATCC 8483]
6HPF_A	4.11e-50	48	339	8	310	Structureof Inactive E165Q mutant of fungal non-CBM carrying GH26 endo-b-mannanase from Yunnania penicillata in complex with alpha-62-61-di-galactosyl-mannotriose [Yunnania penicillata]
3WDQ_A	1.97e-47	49	339	37	352	Crystalstructure of beta-mannanase from a symbiotic protist of the termite Reticulitermes speratus [Symbiotic protist of Reticulitermes speratus],3WDR_A Crystal structure of beta-mannanase from a symbiotic protist of the termite Reticulitermes speratus complexed with gluco-manno-oligosaccharide [Symbiotic protist of Reticulitermes speratus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
G2Q4H7	2.56e-61	46	339	174	476	Mannan endo-1,4-beta-mannosidase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=Man26A PE=1 SV=1
P55298	8.03e-50	45	339	155	459	Mannan endo-1,4-beta-mannosidase C OS=Piromyces sp. OX=45796 GN=MANC PE=2 SV=1
P55297	1.15e-49	45	339	157	461	Mannan endo-1,4-beta-mannosidase B OS=Piromyces sp. OX=45796 GN=MANB PE=2 SV=1
P49425	1.32e-48	46	339	146	457	Mannan endo-1,4-beta-mannosidase OS=Rhodothermus marinus (strain ATCC 43812 / DSM 4252 / R-10) OX=518766 GN=manA PE=1 SV=3
P55296	5.00e-47	45	339	156	460	Mannan endo-1,4-beta-mannosidase A OS=Piromyces sp. OX=45796 GN=MANA PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000002	1.000055	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003858_00859.