CAZyme Information: MGYG000003846_00099

Basic Information

• Lineage: Bacteria; Verrucomicrobiota; Verrucomicrobiae; Opitutales; CAG-312; CAG-312
• CAZyme ID: MGYG000003846_00099
• CAZy Family: GH20
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
582	MGYG000003846_1|CGC2	65103.46	6.1964

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003846	2141960	MAG	United States	North America

• Gene Location: Start: 127155; End: 128903 Strand: -

Full Sequence      

MPSFHAKAKLLPVPKHVKWGDGFLPWERGAFDISPDGLPVGKFVRVDCNCPDVGGRQQYI
LRIDESGIDIKARTVSGAKLALQTLRQIAMQSSQDGLRHVEIMDFPDLQTRGFMLDISRC
KVPTVSELALLVDRLAIMKYNRLELYTEHTYAFVGHELVWADASPMTADQYKRLDSMCRF
AGIELVANINSLGHMERWLRYPQYQYLAESKAPFIDPLGNLRKFPTTLFPDEAAADFMDG
LYAQFFENFTSGKVNIGGDEPWELGMGRSKSLCKCASDKYLLYIEHLKRLNNRVNARGFQ
AYFWADVLMQKPEYAKLIPENMTPVVWGYYLDHPYREQCAYMNSVGREFFVAPGTSTWNS
FGSRWDCARENINTACGCAREFGALGSILTQWGDGGNHQPYSAMFPAIAHHAGCAWSEEP
SEELVCDFLSRCVFCDDTGEFARALVAIGRCDVVDKLFCLHHEMFFADADQARKLSEEYA
GKADFNALISSADFAASLAAASTPKCPDADACIDEIALAARMIMWAFNRAKGDFAVGRTP
SQVELKFIAAEYARVWLMRARLGGLAESVGRIKSVAGSIFAV

Enzyme Prediction     

No EC number prediction in MGYG000003846_00099.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH20	109	418	3.1e-36	0.9554896142433235

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06565	GH20_GcnA-like	6.66e-80	110	417	1	301	Glycosyl hydrolase family 20 (GH20) catalytic domain of N-acetyl-beta-D-glucosaminidase (GcnA, also known as BhsA) and related proteins. GcnA is an exoglucosidase which cleaves N-acetyl-beta-D-galactosamine (NAG) and N-acetyl-beta-D-galactosamine residues from 4-methylumbelliferylated (4MU) substrates, as well as cleaving NAG from chito-oligosaccharides (i.e. NAG polymers). In contrast, sulfated forms of the substrate are unable to be cleaved and act instead as mild competitive inhibitors. Additionally, the enzyme is known to be poisoned by several first-row transition metals as well as by mercury. GcnA forms a homodimer with subunits comprised of three domains, an N-terminal zincin-like domain, this central catalytic GH20 domain, and a C-terminal alpha helical domain. The GH20 hexosaminidases are thought to act via a catalytic mechanism in which the catalytic nucleophile is not provided by solvent or the enzyme, but by the substrate itself.
cd02742	GH20_hexosaminidase	1.72e-19	111	417	2	303	Beta-N-acetylhexosaminidases of glycosyl hydrolase family 20 (GH20) catalyze the removal of beta-1,4-linked N-acetyl-D-hexosamine residues from the non-reducing ends of N-acetyl-beta-D-hexosaminides including N-acetylglucosides and N-acetylgalactosides. These enzymes are broadly distributed in microorganisms, plants and animals, and play roles in various key physiological and pathological processes. These processes include cell structural integrity, energy storage, cellular signaling, fertilization, pathogen defense, viral penetration, the development of carcinomas, inflammatory events and lysosomal storage disorders. The GH20 enzymes include the eukaryotic beta-N-acetylhexosaminidases A and B, the bacterial chitobiases, dispersin B, and lacto-N-biosidase. The GH20 hexosaminidases are thought to act via a catalytic mechanism in which the catalytic nucleophile is not provided by the solvent or the enzyme, but by the substrate itself.
cd06564	GH20_DspB_LnbB-like	1.75e-11	110	306	2	201	Glycosyl hydrolase family 20 (GH20) catalytic domain of dispersin B (DspB), lacto-N-biosidase (LnbB) and related proteins. Dispersin B is a soluble beta-N-acetylglucosamidase found in bacteria that hydrolyzes the beta-1,6-linkages of PGA (poly-beta-(1,6)-N-acetylglucosamine), a major component of the extracellular polysaccharide matrix. Lacto-N-biosidase hydrolyzes lacto-N-biose (LNB) type I oligosaccharides at the nonreducing terminus to produce lacto-N-biose as part of the GNB/LNB (galacto-N-biose/lacto-N-biose I) degradation pathway. The lacto-N-biosidase from Bifidobacterium bifidum has this GH20 domain, a carbohydrate binding module 32, and a bacterial immunoglobulin-like domain 2, as well as a YSIRK signal peptide and a G5 membrane anchor at the N and C termini, respectively. The GH20 hexosaminidases are thought to act via a catalytic mechanism in which the catalytic nucleophile is not provided by solvent or the enzyme, but by the substrate itself.
COG3525	Chb	3.72e-08	51	335	200	539	N-acetyl-beta-hexosaminidase [Carbohydrate transport and metabolism].
pfam00728	Glyco_hydro_20	1.85e-06	111	335	4	271	Glycosyl hydrolase family 20, catalytic domain. This domain has a TIM barrel fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QXD32698.1	1.27e-105	57	578	69	595
QZT36946.1	3.27e-100	2	576	56	635
QZT38683.1	6.08e-97	57	576	103	638
ADE55236.1	4.19e-95	106	573	14	467
ADK80331.1	4.28e-95	10	575	6	589

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4C7D_A	5.77e-06	55	260	78	302	Structureand activity of the GH20 beta-N-acetylhexosaminidase from Streptomyces coelicolor A3(2) [Streptomyces coelicolor],4C7D_B Structure and activity of the GH20 beta-N-acetylhexosaminidase from Streptomyces coelicolor A3(2) [Streptomyces coelicolor],4C7F_A Structure and activity of the GH20 beta-N-acetylhexosaminidase from Streptomyces coelicolor A3(2) [Streptomyces coelicolor],4C7F_B Structure and activity of the GH20 beta-N-acetylhexosaminidase from Streptomyces coelicolor A3(2) [Streptomyces coelicolor]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P43077	3.38e-12	53	327	108	388	Beta-hexosaminidase OS=Candida albicans OX=5476 GN=HEX1 PE=1 SV=1
P49009	7.83e-12	53	327	125	395	Beta-hexosaminidase subunit alpha OS=Entamoeba histolytica OX=5759 GN=HEXA PE=1 SV=2
Q86M34	3.17e-11	53	327	129	399	Beta-hexosaminidase subunit beta OS=Entamoeba histolytica OX=5759 GN=HEXB PE=1 SV=1
P13723	8.54e-10	23	260	67	308	Beta-hexosaminidase subunit A1 OS=Dictyostelium discoideum OX=44689 GN=hexa1 PE=1 SV=1
Q54SC9	1.40e-08	34	333	86	368	Beta-hexosaminidase subunit A2 OS=Dictyostelium discoideum OX=44689 GN=hexa2 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000078	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003846_00099.