CAZyme Information: MGYG000003834_01793

Basic Information

• Species: Eisenbergiella sp900550285
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Eisenbergiella; Eisenbergiella sp900550285
• CAZyme ID: MGYG000003834_01793
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
660	MGYG000003834_16|CGC1	75830.87	6.6976

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003834	2806677	MAG	United States	North America

• Gene Location: Start: 13607; End: 15589 Strand: +

Full Sequence      

MEHQQQQPSSAQKNFQDAYEKEHYKAVYLANRVAQLEDQVDDLQFKLDRIKNNPVWKASA
PARKCMHFVIRQKDRLKNCGSLSGVIQKMRYKAWEKKAMTHYGTASFPTQEERERQEQAV
FERMPKISILVPLWNTPQDFLQEMIGSVQKQTYANWELCLADGSDDAHAYVGEYCRKLAE
KDPRIVYQKLAKNEGISGNTNQCYKLATGEFIGLFDHDDILHPCALYEYVKAINEQDADF
VYCDEATFKSPDIDRMITMHFKPDYAIDNLRANNYICHFSVFARDLLEGTELFRTQFDGS
QDHDMILRLTDNAKKVVHVPKLLYYWRAHAGSVAGNIEAKPYVVEAARGAVADHLRRHGF
SHFTITSTRAFETIFKISYEIIGEPKISIVIPNKDHAEDLRRCIKSIVEKSTWENYEIIV
VENNSETKEIFSYYEELKNNPQIKIVTYEGAFNYSKINNLGVSQATGDYVLLLNNDTQVI
TVNWMEELLMYAQRQDVGAVGGKLYYGDKTIQHAGVVIGLGAHRTAGHVHYRQKRENLGY
MGRLCYAQNMTAVTGACLMVKKKLYEAAGGLDEGFAVSLNDVDFCLKLRRMGYLNVFTPF
AELYHFESVSRGLDDQGEKAARYNEESARFREKWKAELEAGDPYFNPNFSLDKSDFSLRV

Enzyme Prediction     

No EC number prediction in MGYG000003834_01793.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	388	565	1.1e-22	0.9705882352941176
GT2	128	287	1.6e-21	0.9705882352941176

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04184	GT2_RfbC_Mx_like	2.73e-85	125	328	1	202	Myxococcus xanthus RfbC like proteins are required for O-antigen biosynthesis. The rfbC gene encodes a predicted protein of 1,276 amino acids, which is required for O-antigen biosynthesis in Myxococcus xanthus. It is a subfamily of Glycosyltransferase Family GT2, which includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds.
cd04186	GT_2_like_c	6.24e-42	389	607	1	166	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
COG1216	GT2	1.57e-27	383	633	1	245	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
cd06433	GT_2_WfgS_like	2.44e-22	128	332	1	199	WfgS and WfeV are involved in O-antigen biosynthesis. Escherichia coli WfgS and Shigella dysenteriae WfeV are glycosyltransferase 2 family enzymes involved in O-antigen biosynthesis. GT-2 enzymes have GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
pfam00535	Glycos_transf_2	1.08e-19	388	565	1	164	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADL33299.1	0.0	14	660	5	673
QNM02106.1	0.0	14	659	5	678
AOZ95572.1	0.0	14	660	5	675
QUO22278.1	2.44e-298	31	659	5	629
CAB1243278.1	2.18e-238	21	659	386	1033

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P55465	1.36e-123	125	658	366	897	Uncharacterized protein y4gI OS=Sinorhizobium fredii (strain NBRC 101917 / NGR234) OX=394 GN=NGR_a03550 PE=4 SV=1
Q50864	9.47e-83	119	659	313	841	O-antigen biosynthesis protein RfbC OS=Myxococcus xanthus OX=34 GN=rfbC PE=4 SV=1
Q58457	5.95e-11	125	327	8	212	Uncharacterized glycosyltransferase MJ1057 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) OX=243232 GN=MJ1057 PE=3 SV=2
P77414	1.34e-09	125	319	5	207	Putative colanic acid biosynthesis glycosyl transferase WcaA OS=Escherichia coli (strain K12) OX=83333 GN=wcaA PE=4 SV=1
A0A0H2UR96	3.04e-08	127	241	5	116	Glycosyltransferase GlyG OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=glyG PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999732	0.000176	0.000065	0.000003	0.000001	0.000039

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003834_01793.