CAZyme Information: MGYG000003834_00056

Basic Information

• Species: Eisenbergiella sp900550285
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Eisenbergiella; Eisenbergiella sp900550285
• CAZyme ID: MGYG000003834_00056
• CAZy Family: CBM9
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
352	MGYG000003834_1|CGC3	40322.98	4.3106

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003834	2806677	MAG	United States	North America

• Gene Location: Start: 64402; End: 65460 Strand: -

Full Sequence      

MSKINIPIPAVDFQPPVYVCRRAAGEFTLDGRLDKPFWENAPWTDAFLDIEGSHMPLPRF
LTRAKMLWDDENIYFGAQLDGDEIWGHITDRDAVIFYDNDFEIFIDPDSDTQQYYEFEMN
VLNTVWDLFLPIAYRDGGDALNGFDYHGLRTAVHVDGTVNDPSAKNNSWSVEVVIPFASL
NECLPGQPVPASGDFYRLNFSRVQWKVDVDENGYHKRTDENGKPLPEDNWVWAPTGVINI
HYPELWGFLFFAGENDSETAFSIPEDEKRKWELRKLYYAEKIHFDLHGCYTADIDVLKAI
LKEYAPNEKNTSVREGLAYTVEATSHGFELSCPAEEDGHEIVLFGNGKVKKI

Enzyme Prediction     

No EC number prediction in MGYG000003834_00056.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM9	30	207	7e-36	0.8296703296703297

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd09620	CBM9_like_3	1.46e-66	29	248	1	200	DOMON-like type 9 carbohydrate binding module. Family 9 carbohydrate-binding modules (CBM9) play a role in the microbial degradation of cellulose and hemicellulose (materials found in plants). The domain has previously been called cellulose-binding domain. The polysaccharide binding sites of CBMs with available 3D structure have been found to be either flat surfaces with interactions formed by predominantly aromatic residues (tryptophan and tyrosine), or extended shallow grooves. CBM9 domains found in this uncharacterized heterogeneous subfamily may co-occur with various other domains.
cd09618	CBM9_like_2	2.48e-22	17	203	1	170	DOMON-like type 9 carbohydrate binding module. Family 9 carbohydrate-binding modules (CBM9) play a role in the microbial degradation of cellulose and hemicellulose (materials found in plants). The domain has previously been called cellulose-binding domain. The polysaccharide binding sites of CBMs with available 3D structure have been found to be either flat surfaces with interactions formed by predominantly aromatic residues (tryptophan and tyrosine), or extended shallow grooves. CBM9 domains found in this uncharacterized subfamily are typically found at the N-terminus of longer proteins that lack additional annotation with domain footprints.
pfam06452	CBM9_1	5.49e-09	29	180	1	132	Carbohydrate family 9 binding domain-like. CBM9_1 is a C-terminal domain on bacterial xylanase proteins, and it is tandemly repeated in a number of family-members. The CBM9 module binds to amorphous and crystalline cellulose and a range of soluble di- and monosaccharides as well as to cello- and xylo- oligomers of different degrees of polymerization. Comparison of the glucose and cellobiose complexes during crystallisation reveals surprising differences in binding of these two substrates by CBM9-2. Cellobiose was found to bind in a distinct orientation from glucose, while still maintaining optimal stacking and electrostatic interactions with the reducing end sugar.
cd00241	DOMON_like	8.03e-09	51	180	9	127	Domon-like ligand-binding domains. DOMON-like domains can be found in all three kindgoms of life and are a diverse group of ligand binding domains that have been shown to interact with sugars and hemes. DOMON domains were initially thought to confer protein-protein interactions. They were subsequently found as a heme-binding motif in cellobiose dehydrogenase, an extracellular fungal oxidoreductase that degrades both lignin and cellulose, and in ethylbenzene dehydrogenase, an enzyme that aids in the anaerobic degradation of hydrocarbons. The domain interacts with sugars in the type 9 carbohydrate binding modules (CBM9), which are present in a variety of glycosyl hydrolases, and it can also be found at the N-terminus of sensor histidine kinases.
cd09619	CBM9_like_4	5.44e-04	63	115	39	89	DOMON-like type 9 carbohydrate binding module. Family 9 carbohydrate-binding modules (CBM9) play a role in the microbial degradation of cellulose and hemicellulose (materials found in plants). The domain has previously been called cellulose-binding domain. The polysaccharide binding sites of CBMs with available 3D structure have been found to be either flat surfaces with interactions formed by predominantly aromatic residues (tryptophan and tyrosine), or extended shallow grooves. CBM9 domains found in this uncharacterized heterogeneous subfamily are often located at the C-terminus of longer proteins and may co-occur with various other domains.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCJ97215.1	1.12e-186	1	350	1	350
QLG42346.1	1.79e-130	1	351	1	339
QOS77319.1	7.23e-130	1	351	1	339
QOT09656.1	1.22e-128	1	349	1	338
QZN78207.1	5.51e-127	1	351	1	339

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000029	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003834_00056.