CAZyme Information: MGYG000003834_00017

Basic Information

• Species: Eisenbergiella sp900550285
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Eisenbergiella; Eisenbergiella sp900550285
• CAZyme ID: MGYG000003834_00017
• CAZy Family: GH3
• CAZyme Description: Beta-glucosidase BoGH3B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
803	MGYG000003834_1|CGC1	88164.51	4.6983

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003834	2806677	MAG	United States	North America

• Gene Location: Start: 18960; End: 21371 Strand: +

Full Sequence      

MEKYMDQTLSPQERAQDLLEKMSLEEKIRQLGCTMVIPAIPMEYQDLSGGIGVSIVMGVN
DDYADALEKVQKYIMEQSPHHIPALFHGEALAGPVSLLGGSLYPISIGLGATFEPEIARE
MSEFTRRQMLANGIRHGLSPVADLARDLRWGRTNETYGSDPTLSAEMTVEFVKGLQGENP
ADAVAATGKHFLGYSQTEGGLNCHKVMVSPRELREQFAKPFEAAIREAGLMSMMNCYSAI
DGQPVCASKEILTDLLRTDLGFDGVVISDYGSVAQLMDPYHIADDPTEAGIRCLEAGLDI
EAPARIGYDDRLAIAVREGRLSEDVVNLSVLRILTLKFKLGLFENPFPRKENLKEAMDNT
VSNQKSYQAAQKTMTLMKNNGILPITDRKKKILVTGPTGNCLRMMYSHYTAVAGQEMLAS
LASEGDTQQGFDIAGLLANAGEDAGALDRLTEFAMSGQKNGMMDKYVIDNMIRRLYPDAK
TIYEALCDHVDEVRFIEGCDYKGEDESGISEAVCAAKEADIVILAVGGKNGVGQSATTGE
GIDSVSLNLPDIQEKLMREIYAANKNIVIVHTDGRPLVSEWAYEHAAAILEGWLPNTYGG
NAMADVLCGVYNPAGRTPVDVPRSVGHMPVYHCQANGSSGTKNLGMMGLGYIDAKASVLA
PFGYGESYTTFEYHDMQALLDGTTGTVTVTVEVENTGKLPGEEVVQLYGSDLCASMIRPV
QELIGFKRISLQPGERKRVQFIFDIDFFAFLDREMEWIVEKGKFRLMIGSNSRDVRTEQM
ITWNRTEKIDYRKRSLYASAAVL

Enzyme Prediction     

No EC number prediction in MGYG000003834_00017.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	76	302	3.9e-62	0.9814814814814815

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	5.85e-122	9	779	29	761	beta-glucosidase BglX.
COG1472	BglX	6.52e-83	22	397	1	362	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam00933	Glyco_hydro_3	1.07e-64	23	336	1	316	Glycosyl hydrolase family 3 N terminal domain.
PLN03080	PLN03080	1.31e-52	4	678	42	643	Probable beta-xylosidase; Provisional
pfam01915	Glyco_hydro_3_C	5.03e-37	374	668	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBL26978.1	8.76e-224	4	803	7	787
QRT51214.1	2.80e-194	1	802	1	799
AIQ31495.1	5.19e-193	4	798	7	800
QJD85009.1	4.29e-181	3	802	5	809
AFH61237.1	6.63e-181	4	802	8	812

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XXL_A	3.27e-108	18	777	17	746	Crystalstructure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXL_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXM_A Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482],5XXM_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482]
5XXN_A	1.75e-107	18	777	17	746	CrystalStructure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXN_B Crystal Structure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXO_A Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482],5XXO_B Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482]
5YOT_A	1.23e-102	3	776	6	749	Isoprimeverose-producingenzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YOT_B Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YQS_A Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YQS_B Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40]
7EAP_A	9.12e-102	3	776	6	749	ChainA, Fn3_like domain-containing protein [Aspergillus oryzae RIB40]
5Z87_A	2.97e-99	4	775	36	777	ChainA, EmGH1 [Aurantiacibacter marinus],5Z87_B Chain B, EmGH1 [Aurantiacibacter marinus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q56078	1.31e-101	17	776	40	758	Periplasmic beta-glucosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bglX PE=3 SV=2
T2KMH0	1.84e-101	82	773	65	711	Beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22130 PE=1 SV=1
P33363	3.92e-98	17	776	40	758	Periplasmic beta-glucosidase OS=Escherichia coli (strain K12) OX=83333 GN=bglX PE=3 SV=2
T2KMH9	3.58e-93	4	774	29	746	Putative beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22230 PE=2 SV=1
A7LXU3	9.64e-92	19	788	43	781	Beta-glucosidase BoGH3B OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02659 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000077	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003834_00017.