CAZyme Information: MGYG000003831_01428

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; CAG-485
• CAZyme ID: MGYG000003831_01428
• CAZy Family: GH97
• CAZyme Description: Retaining alpha-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
657	MGYG000003831_38|CGC1	75078.38	6.5084

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003831	3246644	MAG	United States	North America

• Gene Location: Start: 10070; End: 12043 Strand: +

Full Sequence      

MRRIKGKFRPSSDMKRIFIFGLLAAGLSTMSAQELSLTSPGDVHSVRIGYVKGAKGDLRY
SVDFLGRELIGDSRMGLDLDNHDWEMALALGKRQLKSPDCWMDNFTVDSVAVHAPVDKEW
KPLYGERSEIKDRYNSGTMYLSKKDGSNYRLNIEVRAYDEGIAFRYYFPEHPAAVFHKVV
EDLTEYTFPAGVMAWSEDWAQAPFERKAIGEIERPVERALTLEYPDGKTWCALTDADVDD
WCLTKYIADSKKPNVLRSVMYSPVDIVTYYATPWKVIMGAETPGELLEHNDIILNLNPPC
EITDASWVKPGKIMRETTLTMEGAKATIDFCAKHNIPYMLFDWKWYEPCTSHDGDATKVI
DRLDMKKVVEYGREHGVGIWLYVNQHALMKQQRELFPLLHEWGIVGVKSGFVQYASHRWA
TWLHDMVRYAAENKLMMNIHDEFRPSGFSRTYPNLLTQEGIHGNEEWPDATHNVTLPFTR
MINGAADYTICYYDPRLKKTTHAHQLAASLVFYSPLQTIFWYDTPSRSKDEPELEWFDNL
ATVFDDSKVLSGYPGRNVTIARKAGDAWYLGAMTNNDARTEKVNLSFLNPDETYLAQIYT
DDPSVDTATKVRCRYMTVKSTDAMTFNLPASGGAAVRFIPVSGKDIKKYKRYKGQSL

Enzyme Prediction     

No EC number prediction in MGYG000003831_01428.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH97	27	638	1.4e-162	0.9889064976228209

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam10566	Glyco_hydro_97	2.63e-59	304	533	1	269	Glycoside hydrolase 97. This domain is the catalytic region of the bacterial glycosyl-hydrolase family 97. This central part of the GH97 family protein sequences represents a typical and complete (beta/alpha)8-barrel or catalytic TIM-barrel type domain. The N- and C-terminal parts of the sequences, mainly consisting of beta-strands, form two additional non-catalytic domains. In all known glycosidases with the (beta-alpha)8-barrel fold, the amino acid residues at the active site are located on the C-termini of the beta-strands.
pfam14508	GH97_N	8.48e-54	53	299	13	235	Glycosyl-hydrolase 97 N-terminal. This N-terminal domain of glycosyl-hydrolase-97 contributes part of the active site pocket. It is also important for contact with the catalytic and C-terminal domains of the whole.
pfam14509	GH97_C	6.23e-35	544	639	1	97	Glycosyl-hydrolase 97 C-terminal, oligomerization. Glycosyl-hydrolase-97 is made up of three tightly linked and highly conserved globular domains. The C-terminal domain is found to be necessary for oligomerization of the whole molecule in order to create the active-site pocket and the Ca++-binding site.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AII66307.1	0.0	15	657	3	645
QJR54190.1	0.0	15	657	3	645
QJR61012.1	0.0	15	657	3	645
ABR37847.1	0.0	14	657	1	645
ALA72156.1	0.0	15	657	3	645

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5E1Q_A	6.89e-57	58	637	35	653	Mutant(D415G) GH97 alpha-galactosidase in complex with Gal-Lac [Bacteroides thetaiotaomicron VPI-5482],5E1Q_B Mutant (D415G) GH97 alpha-galactosidase in complex with Gal-Lac [Bacteroides thetaiotaomicron VPI-5482]
3A24_A	5.17e-56	58	637	21	639	Crystalstructure of BT1871 retaining glycosidase [Bacteroides thetaiotaomicron],3A24_B Crystal structure of BT1871 retaining glycosidase [Bacteroides thetaiotaomicron]
5HQ4_A	1.44e-51	60	638	23	658	AGlycoside Hydrolase Family 97 enzyme from Pseudoalteromonas sp. strain K8 [Pseudoalteromonas sp. K8],5HQA_A A Glycoside Hydrolase Family 97 enzyme in complex with Acarbose from Pseudoalteromonas sp. strain K8 [Pseudoalteromonas sp. K8]
5HQC_A	1.44e-51	60	638	23	658	AGlycoside Hydrolase Family 97 enzyme R171K variant from Pseudoalteromonas sp. strain K8 [Pseudoalteromonas sp. K8]
5HQB_A	3.69e-51	60	638	23	658	AGlycoside Hydrolase Family 97 enzyme (E480Q) in complex with Panose from Pseudoalteromonas sp. strain K8 [Pseudoalteromonas sp. K8]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8A6L0	1.10e-55	14	637	1	660	Retaining alpha-galactosidase OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=BT_1871 PE=1 SV=1
G8JZS4	5.13e-51	14	654	1	734	Glucan 1,4-alpha-glucosidase SusB OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=susB PE=1 SV=1
D7CFN7	7.58e-42	23	603	10	590	Probable retaining alpha-galactosidase OS=Streptomyces bingchenggensis (strain BCW-1) OX=749414 GN=SBI_01652 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.001707	0.996758	0.000854	0.000238	0.000212	0.000191

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003831_01428.