CAZyme Information: MGYG000003827_01234

Basic Information

• Species: 51-20 sp900539605
• Lineage: Bacteria; Proteobacteria; Alphaproteobacteria; RF32; CAG-239; 51-20; 51-20 sp900539605
• CAZyme ID: MGYG000003827_01234
• CAZy Family: GT51
• CAZyme Description: Penicillin-binding protein 1F

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
629	MGYG000003827_13|CGC1	69772.66	10.0524

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003827	1662387	MAG	United States	North America

• Gene Location: Start: 34681; End: 36570 Strand: +

Full Sequence      

MAEIKTKSKKNGTNKKSSAKKNKKSGGGTSKKNVKVKRKTSRRRQKNFSWWKLLLLTGLV
TAAALALYVAYCFVTLPDIEQAVSRTRQPSTTVIAENGQEIRSFGNVYSEVVYPSELPSY
VKNAIIATEDRRFYSHFGFDPIAFTRAMVANLIKGRYAQGGSTITQQVAKNLFLTPQKNI
RRKVQELLMAFWLESKFSKDQILTLYLNRVYMGSGTYGIEAASQKYFQKSSRDLNMLEGA
ILAGLLKAPARYNPAADLERSVARAAVVLQNMVDTAIIAPEQKTAALRMPIGAQIHDKLE
GGKYFADWVYAEVNAYIGERENDINVYTTLDKEIQKAAESALRETVFANAETKNVTNGAV
VVLDKNGAVKAMAGGVNYEKSQFNRATQALRQPGSSFKTFVYLTALENGWKRDDTLEDFP
ITIGNWKPENYDKKYYGTVTFENAFIRSLNLATVYLAQQISRKEIIRTAHKTGISTPIDN
TPAMALGSSGVKVIDMAVAYSAIANGGYATWPYSITEIYTKDGYPVYTRISEEEPQRILD
PDAVKNITRMMEKVISRGTGKRAQLPFFAAGKTGTSQDYRDAWFVGFTEHYVAAVWVGND
DNTPMNGVGGGTLPAEIWKKVMLAAENGG

Enzyme Prediction     

No EC number prediction in MGYG000003827_01234.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	98	273	3.9e-65	0.9887005649717514

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR02074	PBP_1a_fam	0.0	116	625	9	528	penicillin-binding protein, 1A family. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of bifunctional transglycosylase/transpeptidase penicillin-binding proteins (PBP). In the Proteobacteria, this family includes PBP 1A but not the paralogous PBP 1B (TIGR02071). This family also includes related proteins, often designated PBP 1A, from other bacterial lineages. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG0744	MrcB	0.0	74	629	39	600	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
COG5009	MrcA	4.47e-163	76	625	34	718	Membrane carboxypeptidase/penicillin-binding protein [Cell wall/membrane/envelope biogenesis].
TIGR02071	PBP_1b	9.96e-120	115	622	153	679	penicillin-binding protein 1B. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of a particular bifunctional transglycosylase/transpeptidase in E. coli and other Proteobacteria, designated penicillin-binding protein 1B. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
TIGR02073	PBP_1c	8.91e-111	84	618	5	536	penicillin-binding protein 1C. This subfamily of the penicillin binding proteins includes the member from E. coli designated penicillin-binding protein 1C. Members have both transglycosylase and transpeptidase domains and are involved in forming cross-links in the late stages of peptidoglycan biosynthesis. All members of this subfamily are presumed to have the same basic function. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QJR98160.1	2.98e-283	56	626	48	615
QQP92621.1	5.49e-176	60	628	72	637
AWJ83871.1	5.61e-176	64	628	99	661
QCN95682.1	6.41e-176	64	628	91	653
QCO02797.1	1.81e-175	64	628	91	653

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4OON_A	2.93e-78	93	622	23	719	Crystalstructure of PBP1a in complex with compound 17 ((4Z,8S,11E,14S)-5-(2-amino-1,3-thiazol-4-yl)-14-(5,6-dihydroxy-1,3-dioxo-1,3-dihydro-2H-isoindol-2-yl)-8-formyl-2-methyl-6-oxo-3,10-dioxa-4,7,11-triazatetradeca-4,11-diene-2,12,14-tricarboxylic acid) [Pseudomonas aeruginosa PAO1]
5FGZ_A	8.50e-71	115	604	162	673	E.coli PBP1b in complex with FPI-1465 [Escherichia coli K-12],5HL9_A E. coli PBP1b in complex with acyl-ampicillin and moenomycin [Escherichia coli K-12],5HLA_A E. coli PBP1b in complex with acyl-cephalexin and moenomycin [Escherichia coli K-12],5HLB_A E. coli PBP1b in complex with acyl-aztreonam and moenomycin [Escherichia coli K-12],5HLD_A E. coli PBP1b in complex with acyl-CENTA and moenomycin [Escherichia coli K-12],6YN0_A Structure of E. coli PBP1b with a FtsN peptide activating transglycosylase activity [Escherichia coli K-12],7LQ6_A Chain A, Penicillin-binding protein 1B [Escherichia coli K-12]
3VMA_A	1.20e-70	115	604	183	694	CrystalStructure of the Full-Length Transglycosylase PBP1b from Escherichia coli [Escherichia coli K-12]
3UDF_A	3.09e-67	88	628	19	718	ChainA, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDF_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDI_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDI_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDX_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDX_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE0_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE0_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE1_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE1_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii]
3FWL_A	1.49e-65	115	604	166	677	CrystalStructure of the Full-Length Transglycosylase PBP1b from Escherichia coli [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O66874	4.70e-96	76	618	30	660	Penicillin-binding protein 1A OS=Aquifex aeolicus (strain VF5) OX=224324 GN=mrcA PE=1 SV=1
O87579	4.14e-87	58	628	22	708	Penicillin-binding protein 1A OS=Neisseria lactamica OX=486 GN=mrcA PE=3 SV=1
P0A0Z6	5.77e-87	58	628	22	708	Penicillin-binding protein 1A OS=Neisseria meningitidis serogroup B (strain MC58) OX=122586 GN=mrcA PE=3 SV=1
P0A0Z5	5.77e-87	58	628	22	708	Penicillin-binding protein 1A OS=Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491) OX=122587 GN=mrcA PE=3 SV=1
P38050	1.06e-86	90	629	48	601	Penicillin-binding protein 1F OS=Bacillus subtilis (strain 168) OX=224308 GN=pbpF PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999916	0.000098	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
48	70