CAZyme Information: MGYG000003818_01485

Basic Information

• Species: UMGS1688 sp900545885
• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; CAG-917; UMGS1688; UMGS1688 sp900545885
• CAZyme ID: MGYG000003818_01485
• CAZy Family: GH3
• CAZyme Description: Thermostable beta-glucosidase B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
827	MGYG000003818_7|CGC2	90590.52	6.8129

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003818	1728965	MAG	United States	North America

• Gene Location: Start: 44063; End: 46546 Strand: +

Full Sequence      

MKEQDYTDILKKLSLEEKAALCSGLTFWKTFPVESAGIPSVCMTDGPHGLRKEQESAGTN
IMRESYPATCFPTAVTTASSWDPALLEEMGAAIAQEAKGLGVTTVLGPGVNIKRSPLCGR
NFEYFSEDPFLAGRMGAAWVHGVQKNGIGVSLKHFCANNQEYLRMSIDSIIDERALREIY
LPAFEHVVKTEQPSTVMCSYNRLAGTYLSDNKRMLTDILRDEWGFKGIVVSDWGAVNDRV
EGIKAGLDLEMPGNNGANDKVIVKAVKDGVLSEADLDKVALRMIKFAFECKANEVADAKV
DFDANNALAAKIAAESAVLLKNEDGILPLRKSQKVAVIGALAKTPRYQGSGSSHINPVKT
TSFLQAMDAAGQEYEYADGYTFKGDGYKPALVKKAVEAAKGKDVVLLFIGLTPDYESEGF
DRKHINMPDSHVILAEEIAKVNPNVVVVLSCGSPVQLSSVEPVSKAILNMYLGGQAVGEA
TYRLLYGKVNPSGKLAETFPLKNSDNVVARYFPMGPRTVQYRESIYVGYRYFDAAKKAVM
YPFGYGLSYTDFEYSDLRLSASDIKEGEELVATFKIKNTGNVDGAEIAQVYVKDVKSSIF
RPEKELKGFVKVFLKAGEEKEVSVTLDKRSFAYYNVIIKDWHIESGDFEILVGASSRDIR
LSATVNVTSANPAAPIPDYRTSAPYYYDLTEENEQKRTIPIEQFAALYGASIVDNTPYAK
GEFDCNCSLGDVSVSPTGKFLYGLLTTGAKLVAGHTENRDMVVKSITYMPLRSFMGFTGG
ILSTESVLGLVDMCNGKRGGFKRFCKGFKHDKTLDAYSLKIKGKSKK

Enzyme Prediction     

EC	3.2.1.21	3.2.1.-	3.2.1.45

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	34	252	8.4e-72	0.9768518518518519

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	5.92e-103	69	660	118	758	beta-glucosidase BglX.
COG1472	BglX	3.02e-71	37	359	59	377	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
PLN03080	PLN03080	1.10e-61	68	627	111	743	Probable beta-xylosidase; Provisional
pfam01915	Glyco_hydro_3_C	2.22e-60	317	549	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
pfam00933	Glyco_hydro_3	2.17e-39	36	284	64	314	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QEN03854.1	4.83e-272	4	808	3	800
AGS53344.1	2.43e-260	8	797	5	788
CAJ35242.1	6.83e-260	8	797	7	795
QVK18534.1	1.41e-257	5	795	2	780
AGS53563.1	1.06e-256	8	797	5	789

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7MS2_A	5.60e-251	5	795	4	752	ChainA, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	4.64e-202	1	681	1	677	CrystalStructure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
2X40_A	2.02e-135	4	667	2	713	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]
2X42_A	3.08e-134	4	667	2	713	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with alpha-D-glucose [Thermotoga neapolitana DSM 4359]
3AC0_A	1.26e-113	1	659	1	828	Crystalstructure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P14002	1.53e-250	5	795	4	752	Thermostable beta-glucosidase B OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=bglB PE=1 SV=2
E7CY69	3.04e-204	1	681	1	686	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium longum OX=216816 GN=apy PE=1 SV=1
F6C6C1	1.72e-203	1	681	1	686	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium breve (strain ACS-071-V-Sch8b) OX=866777 GN=HMPREF9228_1477 PE=1 SV=1
Q2U8Y5	4.82e-124	1	663	1	827	Probable beta-glucosidase I OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=bglI PE=3 SV=1
P27034	1.54e-123	8	667	4	810	Beta-glucosidase OS=Rhizobium radiobacter OX=358 GN=cbg-1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999995	0.000036	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003818_01485.