CAZyme Information: MGYG000003812_00445

Basic Information

• Species: Prevotella colorans
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella colorans
• CAZyme ID: MGYG000003812_00445
• CAZy Family: GT51
• CAZyme Description: Biosynthetic peptidoglycan transglycosylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
250	MGYG000003812_8|CGC1	28505.17	10.4733

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003812	2316911	MAG	Canada	North America

• Gene Location: Start: 11159; End: 11911 Strand: -

Full Sequence      

MRAPWLASPFGMRILMKIIRWALSLFFASTILAVVAIRFIPVFVTPLMVIRCFQNGNLTM
HHRWIPLDEMSPHMPVAVMASEDSRFLLHHGFDLDAIGKAAKRNLSSSTTHKYGASTISQ
QTAKNVFLWPGRSWVRKGFEVYFTALIELFWSKQRIMEVYLNSIEMGDGIYGLSACAQYN
FGKSARDLSRNDCALIAATLPNPRRFSSKNPSGYMRLRQRQIKANMRYIPSFPKEGEDYD
PHTAVGGTYR

Enzyme Prediction     

No EC number prediction in MGYG000003812_00445.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	60	226	9e-51	0.9322033898305084

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00056	mtgA	7.31e-108	12	235	2	234	monofunctional biosynthetic peptidoglycan transglycosylase; Provisional
TIGR02070	mono_pep_trsgly	2.21e-79	22	229	10	221	monofunctional biosynthetic peptidoglycan transglycosylase. This family is one of the transglycosylases involved in the late stages of peptidoglycan biosynthesis. Members tend to be small, about 240 amino acids in length, and consist almost entirely of a domain described by pfam00912 for transglycosylases. Species with this protein will have several other transglycosylases as well. All species with this protein are Proteobacteria that produce murein (peptidoglycan). [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG0744	MrcB	1.71e-66	1	227	9	241	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
pfam00912	Transgly	3.24e-66	61	227	12	177	Transglycosylase. The penicillin-binding proteins are bifunctional proteins consisting of transglycosylase and transpeptidase in the N- and C-terminus respectively. The transglycosylase domain catalyzes the polymerization of murein glycan chains.
TIGR02074	PBP_1a_fam	9.28e-47	62	227	1	166	penicillin-binding protein, 1A family. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of bifunctional transglycosylase/transpeptidase penicillin-binding proteins (PBP). In the Proteobacteria, this family includes PBP 1A but not the paralogous PBP 1B (TIGR02071). This family also includes related proteins, often designated PBP 1A, from other bacterial lineages. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AGB29041.1	1.67e-147	19	250	2	233
VEH15611.1	2.11e-125	14	249	4	242
ALO48142.1	2.01e-116	12	250	1	241
QNT65514.1	8.16e-116	17	247	8	240
QUB46829.1	1.91e-114	17	238	6	230

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3NB6_A	4.97e-23	64	207	22	164	Crystalstructure of Aquifex aeolicus peptidoglycan glycosyltransferase in complex with Methylphosphoryl Neryl Moenomycin [Aquifex aeolicus]
2OQO_A	6.96e-23	64	207	22	164	Crystalstructure of a peptidoglycan glycosyltransferase from a class A PBP: insight into bacterial cell wall synthesis [Aquifex aeolicus VF5],3D3H_A Crystal structure of a complex of the peptidoglycan glycosyltransferase domain from Aquifex aeolicus and neryl moenomycin A [Aquifex aeolicus],3NB7_A Crystal structure of Aquifex Aeolicus Peptidoglycan Glycosyltransferase in complex with Decarboxylated Neryl Moenomycin [Aquifex aeolicus]
5U2G_A	9.31e-20	77	211	55	185	2.6Angstrom Resolution Crystal Structure of Penicillin-Binding Protein 1A from Haemophilus influenzae [Haemophilus influenzae Rd KW20],5U2G_B 2.6 Angstrom Resolution Crystal Structure of Penicillin-Binding Protein 1A from Haemophilus influenzae [Haemophilus influenzae Rd KW20]
3DWK_A	5.23e-19	50	207	18	171	ChainA, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_B Chain B, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_C Chain C, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_D Chain D, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL]
4OON_A	7.67e-19	77	207	54	183	Crystalstructure of PBP1a in complex with compound 17 ((4Z,8S,11E,14S)-5-(2-amino-1,3-thiazol-4-yl)-14-(5,6-dihydroxy-1,3-dioxo-1,3-dihydro-2H-isoindol-2-yl)-8-formyl-2-methyl-6-oxo-3,10-dioxa-4,7,11-triazatetradeca-4,11-diene-2,12,14-tricarboxylic acid) [Pseudomonas aeruginosa PAO1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8A8H2	2.61e-85	17	233	9	230	Biosynthetic peptidoglycan transglycosylase OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=mtgA PE=3 SV=1
Q3V815	1.06e-79	17	233	8	226	Biosynthetic peptidoglycan transglycosylase OS=Bacteroides fragilis (strain YCH46) OX=295405 GN=mtgA PE=3 SV=1
Q3V7G2	1.06e-79	17	233	8	226	Biosynthetic peptidoglycan transglycosylase OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / CCUG 4856 / JCM 11019 / NCTC 9343 / Onslow) OX=272559 GN=mtgA PE=3 SV=1
Q3V7R3	1.07e-64	22	237	15	230	Biosynthetic peptidoglycan transglycosylase OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIMB 9529 / HD100) OX=264462 GN=mtgA PE=3 SV=1
Q4UXB0	3.19e-60	19	229	21	237	Biosynthetic peptidoglycan transglycosylase OS=Xanthomonas campestris pv. campestris (strain 8004) OX=314565 GN=mtgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000019	0.000005	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
21	43