CAZyme Information: MGYG000003783_00258

Basic Information

• Species: Anaerosacchariphilus sp002160765
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Anaerosacchariphilus; Anaerosacchariphilus sp002160765
• CAZyme ID: MGYG000003783_00258
• CAZy Family: GT11
• CAZyme Description: O-antigen biosynthesis glycosyltransferase WbnK

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
288	MGYG000003783_9|CGC1	34264.82	8.8487

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003783	3019490	MAG	Canada	North America

• Gene Location: Start: 5273; End: 6139 Strand: -

Full Sequence      

MIVMRIKGGLGNQLFQYAAAYAISKRLGQPLEFDPSFTANMTARQYKLPQLCVKSFDIVD
IDKLPKAVLHLKNIYINKIFRILNISRYRCSNYLYLLETRDRLLPDFFTINDSNLYIDGY
FQSEEYFKEYRKDLIAQLCPKYKPEKEYVEALNTICGCNSVAVHVRRSDFKKDNCSYHYL
LDEEYYKRAISEMRKRLEFPVFFWFSDDMAWVKEHIGMSPDFRFIQMKTKHGDIDDMMLM
KNCNHIITANSTFSWWAAWLNENENVIRIVPKKPYGMEKMIPNGWIKL

Enzyme Prediction     

No EC number prediction in MGYG000003783_00258.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT11	1	287	2.6e-71	0.9927536231884058

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd11301	Fut1_Fut2_like	1.94e-56	1	283	1	264	Alpha-1,2-fucosyltransferase. Alpha-1,2-fucosyltransferases (Fut1, Fut2) catalyze the transfer of alpha-L-fucose to the terminal beta-D-galactose residue of glycoconjugates via an alpha-1,2-linkage, generating carbohydrate structures that exhibit H-antigenicity for blood-group carbohydrates. These structures also act as ligands for morphogenesis, the adhesion of microbes, and metastasizing cancer cells. Fut1 is responsible for producing the H antigen on red blood cells. Fut2 is expressed in epithelia of secretory tissues, and individuals termed "secretors" have at least one functional copy of the gene; they secrete H antigen which is further processed into A and/or B antigens depending on the ABO genotype. O-fucosyltransferase-like proteins are GDP-fucose dependent enzymes with similarities to the family 1 glycosyltransferases (GT1). They are soluble ER proteins that may be proteolytically cleaved from a membrane-associated preprotein, and are involved in the O-fucosylation of protein substrates, the core fucosylation of growth factor receptors, and other processes.
pfam01531	Glyco_transf_11	6.68e-29	1	280	32	284	Glycosyl transferase family 11. This family contains several fucosyl transferase enzymes.
cd11548	NodZ_like	7.19e-05	1	260	1	280	Alpha 1,6-fucosyltransferase similar to Bradyrhizobium NodZ. Bradyrhizobium NodZ is an alpha 1,6-fucosyltransferase involved in the biosynthesis of the nodulation factor, a lipo-chitooligosaccharide formed by three-to-six beta-1,4-linked N-acetyl-d-glucosamine (GlcNAc) residues and a fatty acid acyl group attached to the nitrogen atom at the non-reducing end. NodZ transfers L-fucose from the GDP-beta-L-fucose donor to the reducing residue of the chitin oligosaccharide backbone, before the attachment of a fatty acid group. O-fucosyltransferase-like proteins are GDP-fucose dependent enzymes with similarities to the family 1 glycosyltransferases (GT1). They are soluble ER proteins that may be proteolytically cleaved from a membrane-associated preprotein, and are involved in the O-fucosylation of protein substrates, the core fucosylation of growth factor receptors, and other processes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAA33632.1	8.59e-49	1	285	1	278
AMK78698.1	1.93e-46	1	288	1	291
AKF24141.1	1.93e-46	1	288	1	291
QOS24814.1	2.10e-44	1	288	1	287
QFC18227.1	2.10e-44	1	288	1	287

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q58YV9	4.54e-26	6	288	5	302	O-antigen biosynthesis glycosyltransferase WbnK OS=Escherichia coli OX=562 GN=wbnK PE=1 SV=1
P97353	3.74e-12	1	266	70	311	Galactoside 2-alpha-L-fucosyltransferase Sec1 OS=Mus musculus OX=10090 GN=Sec1 PE=2 SV=1
Q10982	2.69e-11	8	266	67	301	Galactoside alpha-(1,2)-fucosyltransferase 2 OS=Sus scrofa OX=9823 GN=FUT2 PE=1 SV=3
Q10984	3.13e-10	1	266	74	315	Galactoside alpha-(1,2)-fucosyltransferase 2 OS=Rattus norvegicus OX=10116 GN=Fut2 PE=1 SV=2
Q9TTY3	4.41e-10	1	260	86	321	Galactoside 2-alpha-L-fucosyltransferase SEC1 OS=Bos taurus OX=9913 GN=SEC1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000075	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003783_00258.