CAZyme Information: MGYG000003783_00098

Basic Information

• Species: Anaerosacchariphilus sp002160765
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Anaerosacchariphilus; Anaerosacchariphilus sp002160765
• CAZyme ID: MGYG000003783_00098
• CAZy Family: GH36
• CAZyme Description: Bifunctional alpha-galactosidase/sucrose kinase AgaSK

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
731	MGYG000003783_3|CGC1	82804.95	5.604

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003783	3019490	MAG	Canada	North America

• Gene Location: Start: 3415; End: 5610 Strand: +

Full Sequence      

MAARYNAETKTFILETAHSSYIMKVSRYGNLLHMYYGSRIPDEDLDYLLTFSDRGFSPNP
YEAGNDRTFSLDFLPQEFSGSRSGDYRSSSLELVWGEGGSAFGGKVAGYEIRKGACRIDG
MPGLWAESQEQAETLTICLADPVSKVEAELSYTVFAEKDVIARSVKLVNRGKDVVRLEKL
MSATIDFRDSDYDLIYFSGRHTMERELRRIAVADGVHAIGSSRGASSHQYNPFAILCEKD
CGEDRGQCWGISLVYSGSFLIEAERDQYKQLRLNAGLNPSGFSFLVEPGGDFQAPQAVLA
WSDQGFTGLSHIYHRIFRENLCRSPFRKKMRPVLLNSWEAAYFDFDDEKILAIAREAADL
GVELFVLDDGWFGKRDNDVSGLGDWTVNQEKIKIGISELSRQIHEMGMQFGIWVEPEMVS
EDSDLYRKHPDWCLREPGRPPVRGRYQLALDLSRRDVCEYLIETMNRLLESARIEYVKWD
MNRSLAETWSALLGTGRQGEVLHRYVLGLYYVMDQVILKHPDVLFCGCCGGGGRFDPAML
YYQPQIWCSDNTDAVNRLKIQYGTSFAYPVSSMEAHVSVCPNHITGRTVPFGTRGIVAMD
GIFGYELDPLKMTAEEKDACRKQIQFYKKYYKVIVDGDYYRLASPYENPYFTAWQQVSQD
KKKSLVSIVITDREGNDAQRFVRLKGLLEDGYYRIEGLKGKYSGKLLMSAGIPVPGSLGE
YEGIQLVLKMA

Enzyme Prediction     

EC	3.2.1.22

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH36	12	713	4e-254	0.9956395348837209

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3345	GalA	0.0	12	726	4	685	Alpha-galactosidase [Carbohydrate transport and metabolism].
pfam02065	Melibiase	1.55e-175	292	637	2	347	Melibiase. Glycoside hydrolase families GH27, GH31 and GH36 form the glycoside hydrolase clan GH-D. Glycoside hydrolase family 36 can be split into 11 families, GH36A to GH36K. This family includes enzymes from GH36A-B and GH36D-K and from GH27.
cd14791	GH36	1.44e-132	331	629	2	299	glycosyl hydrolase family 36 (GH36). GH36 enzymes occur in prokaryotes, eukaryotes, and archaea with a wide range of hydrolytic activities, including alpha-galactosidase, alpha-N-acetylgalactosaminidase, stachyose synthase, and raffinose synthase. All GH36 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH36 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.
pfam16875	Glyco_hydro_36N	6.22e-96	29	283	1	252	Glycosyl hydrolase family 36 N-terminal domain. This domain is found at the N-terminus of many family 36 glycoside hydrolases. It has a beta-supersandwich fold.
pfam16874	Glyco_hydro_36C	2.57e-18	652	728	2	78	Glycosyl hydrolase family 36 C-terminal domain. This domain is found at the C-terminus of many family 36 glycoside hydrolases. It has a beta-sandwich structure with a Greek key motif.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCN32673.1	1.80e-268	1	726	1	726
QJU19082.1	3.60e-266	1	729	1	731
QRP38527.1	7.24e-266	1	729	1	731
ASN96678.1	7.24e-266	1	729	1	731
BCK01162.1	2.36e-263	1	730	1	726

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2YFN_A	1.01e-253	1	725	1	714	galactosidasedomain of alpha-galactosidase-sucrose kinase, AgaSK [[Ruminococcus] gnavus E1],2YFO_A GALACTOSIDASE DOMAIN OF ALPHA-GALACTOSIDASE-SUCROSE KINASE, AGASK, in complex with galactose [[Ruminococcus] gnavus E1]
4FNQ_A	1.33e-243	1	729	1	725	Crystalstructure of GH36 alpha-galactosidase AgaB from Geobacillus stearothermophilus [Geobacillus stearothermophilus]
4FNR_A	2.81e-240	1	729	1	725	Crystalstructure of GH36 alpha-galactosidase AgaA from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4FNR_B Crystal structure of GH36 alpha-galactosidase AgaA from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4FNR_C Crystal structure of GH36 alpha-galactosidase AgaA from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4FNR_D Crystal structure of GH36 alpha-galactosidase AgaA from Geobacillus stearothermophilus [Geobacillus stearothermophilus]
4FNP_A	1.29e-238	1	729	1	725	Crystalstructure of GH36 alpha-galactosidase AgaA A355E from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4FNP_B Crystal structure of GH36 alpha-galactosidase AgaA A355E from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4FNP_C Crystal structure of GH36 alpha-galactosidase AgaA A355E from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4FNP_D Crystal structure of GH36 alpha-galactosidase AgaA A355E from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4FNS_A Crystal structure of GH36 alpha-galactosidase AgaA A355E from Geobacillus stearothermophilus in complex with 1-deoxygalactonojirimycin [Geobacillus stearothermophilus],4FNS_B Crystal structure of GH36 alpha-galactosidase AgaA A355E from Geobacillus stearothermophilus in complex with 1-deoxygalactonojirimycin [Geobacillus stearothermophilus],4FNS_C Crystal structure of GH36 alpha-galactosidase AgaA A355E from Geobacillus stearothermophilus in complex with 1-deoxygalactonojirimycin [Geobacillus stearothermophilus],4FNS_D Crystal structure of GH36 alpha-galactosidase AgaA A355E from Geobacillus stearothermophilus in complex with 1-deoxygalactonojirimycin [Geobacillus stearothermophilus]
4FNU_A	2.60e-238	1	729	1	725	Crystalstructure of GH36 alpha-galactosidase AgaA A355E D478A from Geobacillus stearothermophilus in complex with stachyose [Geobacillus stearothermophilus],4FNU_B Crystal structure of GH36 alpha-galactosidase AgaA A355E D478A from Geobacillus stearothermophilus in complex with stachyose [Geobacillus stearothermophilus],4FNU_C Crystal structure of GH36 alpha-galactosidase AgaA A355E D478A from Geobacillus stearothermophilus in complex with stachyose [Geobacillus stearothermophilus],4FNU_D Crystal structure of GH36 alpha-galactosidase AgaA A355E D478A from Geobacillus stearothermophilus in complex with stachyose [Geobacillus stearothermophilus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
G4T4R7	7.19e-250	1	725	1	714	Bifunctional alpha-galactosidase/sucrose kinase AgaSK OS=Ruminococcus gnavus OX=33038 GN=agaSK PE=1 SV=1
Q9ALJ4	1.54e-239	1	729	1	725	Alpha-galactosidase AgaA OS=Geobacillus stearothermophilus OX=1422 GN=agaA PE=1 SV=1
G1UB44	1.25e-204	4	722	7	722	Alpha-galactosidase Mel36A OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) OX=272621 GN=melA PE=1 SV=1
P43467	2.74e-198	10	721	11	720	Alpha-galactosidase 1 OS=Pediococcus pentosaceus OX=1255 GN=agaR PE=3 SV=1
Q0CEF5	3.18e-159	12	712	18	707	Probable alpha-galactosidase G OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=aglG PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000054	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003783_00098.