CAZyme Information: MGYG000003769_00148

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Lachnoclostridium
• CAZyme ID: MGYG000003769_00148
• CAZy Family: CBM6
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1057	MGYG000003769_1|CGC4	120298.22	4.5418

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003769	4856301	MAG	Canada	North America

• Gene Location: Start: 158885; End: 162058 Strand: +

Full Sequence      

MTIEKILDKEHSFNVDGTTGTPLGGFGAGAIKFNAMNGSFAITTKAPADQHDYYNYENSR
FQLYSKVDEKVQSVDTLTAKCMNGRFDDDAIWPIHRINFGNINDIQMDMVAFSPLETKDY
KLMSLPYAFYEVTVENENSITADVAIAFLWDITTEAIEYTNDKGFSSDSWAVYATSNDAN
ATITTGNDNNFLLSGECNNVTKDAFHKVAVKLSLAAYEKKTIKFVLSWYDNSDPDGAYYL
SQYNNASEIASIGLDNFDHLKGNAVSLVDKMRNSNLPKWFINQSLNSLVNISNNSIFKTD
GRIAFAEGEWTCFGTMDQMWHARKIISELCPFFAWTELEYWARTQRKDGQIHHDFTPFDV
SEQNPKYKLCGWDDTEHPDYRKIDKWVDLNCGLIISVYETYQQTADDERLTFFWPYVKKA
AQRILDQVDLYGDKQYPFTFSTSENSYDAGGDPNPFNTGLSIVAYKIMITLSKRTNDKEL
IDIYQYAFTTAVQSFRNRYLDNNFEAGRISESYFGGQWLALSLKLGQIFTEEETDYVLSE
LDSYYHPLYKGLGYKSGTYDEWTPYILAHYGGLLLNTGRQKQYEYLQKDAYNRQYLNRNY
VFNQPLDILPSITKKIYTSTTISGDKQYISTPAIWRNYYNIVGFHRDKSTNEIWVQPILL
EEMNHTMVDACFITPDGYGTISCNESGLYHQNKDILLKTEFKMEVSSIHLTDNFDDSNII
VTINNTPCNYTRIGEGYSKELLVEWQGIIDSKGIHIVTIGYPGKAPHEDPIYTGDILDIP
ESIPDINAYEIIDATTYSEQAGVNITRDNNGVNYVTDCNNFDYIKFNNIGFETIGAEYIR
LKVSSKLKGSSIQIVLDSVGGEAIATVYIPCTKSDEEWTEVISEIDKTTGTHNVILRFFG
SSEENLLNIATMQFLKSNHFEFIDPSNWTATSSYNNSSAHLAFDGLINTRWHTRAQNGGE
WFLIDMNDEVSFDKITLDSGVKINDYPREYEIYVSNDGINFGTAVASGVGTEGVTIIDLS
LHKARFIKIVQTGKTETTYWSIYNLCVFNTTLRPAME

Enzyme Prediction     

No EC number prediction in MGYG000003769_00148.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM32	929	1045	1.1e-20	0.9193548387096774
CBM6	793	915	4.9e-20	0.8623188405797102

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04084	CBM6_xylanase-like	8.73e-26	792	914	3	123	Carbohydrate Binding Module 6 (CBM6); many are appended to glycoside hydrolase (GH) family 11 and GH43 xylanase domains. This family includes carbohydrate binding module 6 (CBM6) domains that are appended mainly to glycoside hydrolase (GH) family domains, including GH3, GH11, and GH43 domains. These CBM6s are non-catalytic carbohydrate binding domains that facilitate the strong binding of the GH catalytic modules with their dedicated, insoluble substrates. Examples of proteins having CMB6s belonging to this family are Microbispora bispora GghA, a 1,4-beta-D-glucan glucohydrolase (GH3); Clostridium thermocellum xylanase U (GH11), and Penicillium purpurogenum ABF3, a bifunctional alpha-L-arabinofuranosidase/xylobiohydrolase (GH43). GH3 comprises enzymes with activities including beta-glucosidase (hydrolyzes beta-galactosidase) and beta-xylosidase (hydrolyzes 1,4-beta-D-xylosidase). GH11 family comprises enzymes with xylanase (endo-1,4-beta-xylanase) activity which catalyze the hydrolysis of beta-1,4 bonds of xylan, the major component of hemicelluloses, to generate xylooligosaccharides and xylose. GH43 includes beta-xylosidases and beta-xylanases, using aryl-glycosides as substrates. CBM6 is an unusual CBM as it represents a chimera of two distinct binding sites with different modes of binding: binding site I within the loop regions and binding site II on the concave face of the beta-sandwich fold.
COG4354	COG4354	1.62e-23	20	545	14	614	Uncharacterized protein, contains GBA2_N and DUF608 domains [Function unknown].
smart00606	CBD_IV	5.74e-17	786	906	2	124	Cellulose Binding Domain Type IV.
pfam03422	CBM_6	2.05e-16	793	914	1	123	Carbohydrate binding module (family 6).
pfam00754	F5_F8_type_C	7.02e-16	929	1043	3	124	F5/8 type C domain. This domain is also known as the discoidin (DS) domain family.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AUO20229.1	0.0	15	1048	37	1090
ALJ61438.1	0.0	15	914	44	947
QUT92987.1	0.0	15	914	44	947
QCP10011.1	0.0	8	914	33	941
QBI01799.1	1.52e-314	12	914	38	942

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1W9S_A	3.67e-10	787	909	10	133	ChainA, Bh0236 Protein [Halalkalibacterium halodurans],1W9S_B Chain B, Bh0236 Protein [Halalkalibacterium halodurans],1W9T_A Chain A, Bh0236 Protein [Halalkalibacterium halodurans],1W9T_B Chain B, Bh0236 Protein [Halalkalibacterium halodurans],1W9W_A Chain A, Bh0236 Protein [Halalkalibacterium halodurans]
3C7E_A	1.38e-09	783	914	349	484	Crystalstructure of a glycoside hydrolase family 43 arabinoxylan arabinofuranohydrolase from Bacillus subtilis. [Bacillus subtilis],3C7F_A Crystal structure of a glycoside hydrolase family 43 arabinoxylan arabinofuranohydrolase from bacillus subtilis in complex with xylotriose. [Bacillus subtilis],3C7H_A Crystal structure of glycoside hydrolase family 43 arabinoxylan arabinofuranohydrolase from Bacillus subtilis in complex with AXOS-4-0.5. [Bacillus subtilis],3C7O_A Crystal structure of a glycoside hydrolase family 43 arabinoxylan arabinofuranohydrolase from Bacillus subtilis in complex with cellotetraose. [Bacillus subtilis]
3C7G_A	1.38e-09	783	914	350	485	Crystalstructure of a glycoside hydrolase family 43 arabinoxylan arabinofuranohydrolase from Bacillus subtilis in complex with xylotetraose. [Bacillus subtilis]
2V4V_A	1.11e-08	787	902	2	116	CrystalStructure of a Family 6 Carbohydrate-Binding Module from Clostridium cellulolyticum in complex with xylose [Ruminiclostridium cellulolyticum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P45796	8.91e-11	730	914	303	507	Arabinoxylan arabinofuranohydrolase OS=Paenibacillus polymyxa OX=1406 GN=xynD PE=1 SV=1
Q45071	7.96e-09	783	914	375	510	Arabinoxylan arabinofuranohydrolase OS=Bacillus subtilis (strain 168) OX=224308 GN=xynD PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000064	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003769_00148.