CAZyme Information: MGYG000003767_00915

Basic Information

• Species: Bifidobacterium sp002884815
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Actinomycetales; Bifidobacteriaceae; Bifidobacterium; Bifidobacterium sp002884815
• CAZyme ID: MGYG000003767_00915
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
303	MGYG000003767_14|CGC1	34356.78	9.8139

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003767	1161383	MAG	Canada	North America

• Gene Location: Start: 2881; End: 3792 Strand: -

Full Sequence      

MHICAGIITYNPTLTDVSTCLEALCNQVERVIIVDNASKNVKSLQEVVSKYTNVTLVKNS
QNIGFAKALTQVFEWAKSQGFNWVLTLNDDSVVPSNMISEYKKILENQGSLVNQKNAKNS
KIAIVCSLLKNRLDGTILHSKCHEDECITSGSLTSVEAWAKIGGFDEWLEIDGVDFDFSR
RLVRAGWQIVECQNVIMEHQIGKARSINLIIKHPIVWNHNANRKYYIARNMQVVDYKMGT
YSYAKSLRAVVRDMIFVALWEKNKFAKIRAMIRGFKDGQKKIRQMRKISSSKISSCKAEQ
NAV

Enzyme Prediction     

No EC number prediction in MGYG000003767_00915.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	6	103	4.1e-16	0.5823529411764706

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd02526	GT2_RfbF_like	1.71e-56	5	230	1	232	RfbF is a putative dTDP-rhamnosyl transferase. Shigella flexneri RfbF protein is a putative dTDP-rhamnosyl transferase. dTDP rhamnosyl transferases of Shigella flexneri add rhamnose sugars to N-acetyl-glucosamine in the O-antigen tetrasaccharide repeat. Lipopolysaccharide O antigens are important virulence determinants for many bacteria. The variations of sugar composition, the sequence of the sugars and the linkages in the O antigen provide structural diversity of the O antigen.
TIGR01556	rhamnosyltran	4.44e-35	8	278	1	281	L-rhamnosyltransferase. This model subfamily is comprised of gamma proteobacteria whose proteins function as L-rhamnosyltransferases in the synthesis of their respective surface polysaccharides. Rhamnolipids are glycolipids containing mono- or di- L-rhamnose molecules. Rhamnolipid synthesis occurs by sequential glycosyltransferase reactions involving two distinct rhamnosyltransferase enzymes. In P.aeruginosa, the synthesis of mono-rhamnolipids is catalyzed by rhamnosyltransferase 1, and proceeds by a glycosyltransfer reaction catalyzed by rhamnosyltransferase 2 to yield di-rhamnolipids. [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
COG1216	GT2	1.34e-30	3	283	5	295	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
cd04186	GT_2_like_c	2.28e-23	7	199	3	164	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
cd04185	GT_2_like_b	2.30e-10	7	231	3	199	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEF31598.1	6.24e-203	1	303	1	293
BAQ32918.1	6.24e-203	1	303	1	293
SDR97486.1	6.24e-203	1	303	1	293
ADP38494.1	6.24e-203	1	303	1	293
VEH16999.1	2.54e-202	1	303	1	293

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P37782	7.17e-12	2	278	4	284	dTDP-rhamnosyl transferase RfbF OS=Shigella flexneri OX=623 GN=rfbF PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000080	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003767_00915.