CAZyme Information: MGYG000003765_00467

Basic Information

• Species: Prevotella bergensis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella bergensis
• CAZyme ID: MGYG000003765_00467
• CAZy Family: GH127
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
805	MGYG000003765_44|CGC1	90456.73	7.5432

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003765	2329044	MAG	Canada	North America

• Gene Location: Start: 6079; End: 8496 Strand: +

Full Sequence      

MGITVMVSGSLEAAPAKKAGGKTGNLIVEVPFTKVHLNDNFWSPRIEINRTVSIPSAFRE
CEKNGRFDNFAIAGGLMKGEHRGDFSFDDTDPYKVIEGASYSLAVHYDAKLDHYLDSVIS
IIASAQEPDGYLTTCVTNKCYRLSGWWGRSKWEKINSHELYNSGHLIESAVAHYKATGKK
NFLNVAIKNADLVCKTFGPAPNQIHRPSGHPIAEMALCKLYKVTGNRKYLETAKYFVEET
GRGTDGHRLNAYSQDHKPILEQDEIVGHAVRAGYLFSGVADVAALTNDAEYFHALERIWN
NMAGKKLYITGGIGSRAQGEGFGPNYELNNMTAYSETCASIANVYWNYRMFLATGDAKYV
DVYERALYNGVLSGVSLSGKEFFYDNPLESMGQHARQAWFGCACCPGNVTRFVASVPQYQ
YATRGNDIFVNLYIQGKADINGVQLTQTTNYPWDGNISIQVSPKRRSTFAIRFRIPGWAH
NKPVSTNLYHFIDKAKPYAVKLNGDVVDATLEDGYVVISRKWKKGDRVEIELPMDVRRVQ
ANDNVEDDRGKIALERGPVMFCLEGKDQSDNTVFNKIITLTTPITASYHSDKLNGIVELT
GNAMQLEQDGSVKNVRFRAIPYSTWNNRGADQMAVWIASSPAYAYVPPRETIASKAHTRS
NRAPIQKDAPETAVAEGSAWGVNDQWEPRRSSDTSKPYHYWWLKRGTPESIFYAFDKPYT
VSNVQVYWLDFDHYDGNFRVPESWTLYYKDNEGLWKEVEDHTPYGCKKDVYNSVDFRPVT
TTGLRIVAKLQKGESGGIIEWKVNE

Enzyme Prediction     

No EC number prediction in MGYG000003765_00467.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH127	35	562	1.4e-207	0.9980916030534351

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07944	Glyco_hydro_127	0.0	35	562	2	503	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
COG3533	COG3533	1.49e-169	30	638	12	586	Uncharacterized conserved protein, DUF1680 family [Function unknown].
cd04791	LanC_SerThrkinase	2.79e-04	174	313	99	289	Lanthionine synthetase C-like domain associated with serine/threonine kinases. Some members of this subgroup lack the zinc binding site and the active site residues, and therefore are most likely inactive. The function of this domain is unknown.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS84569.1	0.0	27	804	35	812
QUT60192.1	0.0	27	804	31	811
QEW34697.1	0.0	27	804	31	811
QQY38942.1	0.0	27	804	31	811
QQY42147.1	0.0	27	804	31	811

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6EX6_A	2.76e-212	24	650	4	636	TheGH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482],6EX6_B The GH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482]
4QJY_A	2.22e-145	28	637	9	645	Crystalstructure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QJY_B Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
4QK0_A	1.17e-141	28	637	9	645	Crystalstructure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_B Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_C Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_D Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
5MQO_A	4.55e-105	35	637	44	694	Glycosidehydrolase BT_1003 [Bacteroides thetaiotaomicron]
3WRE_A	6.24e-105	47	636	32	655	Thecrystal structure of native HypBA1 from Bifidobacterium longum JCM 1217 [Bifidobacterium longum subsp. longum JCM 1217],3WRG_A The complex structure of HypBA1 with L-arabinose [Bifidobacterium longum subsp. longum JCM 1217]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
E8MGH8	3.42e-104	47	636	32	655	Non-reducing end beta-L-arabinofuranosidase OS=Bifidobacterium longum subsp. longum (strain ATCC 15707 / DSM 20219 / JCM 1217 / NCTC 11818 / E194b) OX=565042 GN=hypBA1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000048	0.000002	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003765_00467.