CAZyme Information: MGYG000003765_00465

Basic Information

• Species: Prevotella bergensis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella bergensis
• CAZyme ID: MGYG000003765_00465
• CAZy Family: GH127
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
819	MGYG000003765_44|CGC1	91959.09	8.4824

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003765	2329044	MAG	Canada	North America

• Gene Location: Start: 1357; End: 3816 Strand: -

Full Sequence      

MKRKIITFLTAMIATAGMAQKSNGGYPITPVPFTAVKVASNSFWGQRLETSRQVTVPLAF
SKCESEGRYKNFERAAHPSDSYDVSKLMGLSFDDTDPYKTIEGASYILQTYPDKKLKQYI
DSVLNIIGSAQESDGYLYTARTQNPKNPHHWAGDKRWSKVEDLSHELYNLGHMVEGAVAH
WQATGSRKFLDIATRYADCVVREVGPNPGQVCVVPGHQIAEMALCKLYLATGNRKYLDQA
KFFLDYRGKTTIRQEYSQSHKPVVEQDEAVGHAVRAAYMYAGMADVAALTGDADYIKAID
RIWDNIVGKKLYITGGIGATSNGEAFGKNYELPNMSAYAETCAAIGNVYVNYRLFLLHGE
SKYFDVLERSLYNGLISGVSMDGGGFFYPNPLESMGQHQRQAWFGCACCPSNICRFLPSL
PGYVYAVKDNNLYVNLFLSNSATMKVNGKNVSLTQSTNYPWDGDIAIRVDRNKAGSFGLK
IRIPGWIKGQPVPSDLYYYSDGKRPNYTILVNGKAIEPTITDDGYCTINRRWKKGDVVTI
HFDMEVRTVRANTKVEADRGQVSFERGPVVYCAEWADNDFDIMSMLLNQKPKFTESKLPY
SQFISDKYKNTLRLYQGQNLTTLTTQAQALAYDKEGRLTVQNVNLKLIPYFAWCHRGSGN
MKVWMAQNVSASRPSTPPTLASQAEIASSTPSRSMKSIVDGLVPADENDRSVPYFHWWPK
QGGNEWVTYTFANAKTIQSATVYWFDDQPWGGCKVPDSWTMEYQDESGAWKPVFHADQYP
VKKGQACIVNFDPVKTKAVRLNVYQPEKYSSGLFEWSVN

Enzyme Prediction     

No EC number prediction in MGYG000003765_00465.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH127	40	572	1.1e-204	0.9923664122137404

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07944	Glyco_hydro_127	0.0	35	572	1	503	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
COG3533	COG3533	1.81e-168	30	666	11	586	Uncharacterized conserved protein, DUF1680 family [Function unknown].
cd04791	LanC_SerThrkinase	7.74e-05	181	302	99	230	Lanthionine synthetase C-like domain associated with serine/threonine kinases. Some members of this subgroup lack the zinc binding site and the active site residues, and therefore are most likely inactive. The function of this domain is unknown.
pfam17132	Glyco_hydro_106	0.004	719	807	202	287	alpha-L-rhamnosidase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS84571.1	0.0	9	818	12	821
AGB29922.1	0.0	9	818	1	815
ADE82616.1	0.0	15	818	18	810
QJR57394.1	0.0	1	818	1	800
QJR78977.1	0.0	1	818	1	800

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6EX6_A	0.0	23	671	2	629	TheGH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482],6EX6_B The GH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482]
4QJY_A	1.16e-138	37	665	11	645	Crystalstructure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QJY_B Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
4QK0_A	2.54e-133	37	665	11	645	Crystalstructure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_B Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_C Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_D Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
3WRE_A	4.43e-105	89	664	70	655	Thecrystal structure of native HypBA1 from Bifidobacterium longum JCM 1217 [Bifidobacterium longum subsp. longum JCM 1217],3WRG_A The complex structure of HypBA1 with L-arabinose [Bifidobacterium longum subsp. longum JCM 1217]
3WKW_A	5.90e-105	89	664	70	655	Crystalstructure of GH127 beta-L-arabinofuranosidase HypBA1 from Bifidobacterium longum ligand free form [Bifidobacterium longum subsp. longum JCM 1217],3WKX_A Crystal structure of GH127 beta-L-arabinofuranosidase HypBA1 from Bifidobacterium longum arabinose complex form [Bifidobacterium longum subsp. longum JCM 1217],7BZL_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217],7DIF_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217],7EXV_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217],7EXW_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
E8MGH8	2.43e-104	89	664	70	655	Non-reducing end beta-L-arabinofuranosidase OS=Bifidobacterium longum subsp. longum (strain ATCC 15707 / DSM 20219 / JCM 1217 / NCTC 11818 / E194b) OX=565042 GN=hypBA1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.006374	0.618841	0.372824	0.001281	0.000380	0.000280

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003765_00465.