CAZyme Information: MGYG000003762_01445

Basic Information

• Species: Corynebacterium aurimucosum_C
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Mycobacteriales; Mycobacteriaceae; Corynebacterium; Corynebacterium aurimucosum_C
• CAZyme ID: MGYG000003762_01445
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
304	MGYG000003762_185|CGC1	32559.5	4.3504

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003762	2238677	MAG	Canada	North America

• Gene Location: Start: 943; End: 1857 Strand: +

Full Sequence      

MGTFGHNFCSAIVVGLVYTVASWRSLCRSTPFLQRAVVFTFMTQGLRRIGGCGLGIVLAI
ILIISLVAWSLSFLDKPSPFRQLSPVPEDLPPVGGAEVPSIDVDGPGRTADKLTWWSDQL
ADATSIPAQALRAYGNAELIARQSWPNCNLRWNTLAGIGWVETRHGTYNGSLFDRSSLDE
NGYPDPPIVGIPLDGTNNTTLVPDSDGGAIDGDVEFDRAVGPMQFIASSWEHLGRDANGD
GVADPNQIDDAALGAAALLCHGDRDLSTPEGWRSAVLNYNQSEDYLRKVAAAANSYAIEQ
PAVS

Enzyme Prediction     

No EC number prediction in MGYG000003762_01445.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	151	297	1.7e-17	0.8148148148148148

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG2951	MltB	2.71e-25	86	297	57	276	Membrane-bound lytic murein transglycosylase B [Cell wall/membrane/envelope biogenesis].
cd13399	Slt35-like	5.28e-16	148	295	1	108	Slt35-like lytic transglycosylase. Lytic transglycosylase similar to Escherichia coli lytic transglycosylase Slt35 and Pseudomonas aeruginosa Sltb1. Lytic transglycosylase (LT) catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc) as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this this family include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, as well as the eukaryotic "goose-type" lysozymes (goose egg-white lysozyme; GEWL).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACP32510.1	4.09e-206	12	304	1	293
QQU93311.1	2.94e-185	42	304	1	263
QQU95257.1	1.98e-183	42	304	1	263
QQA78435.1	9.01e-180	42	304	1	263
SQI00325.1	9.01e-180	42	304	1	263

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000013	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
4	26
49	71