CAZyme Information: MGYG000003755_00637

Basic Information

• Species: Arcanobacterium_A urinimassiliense
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Actinomycetales; Actinomycetaceae; Arcanobacterium_A; Arcanobacterium_A urinimassiliense
• CAZyme ID: MGYG000003755_00637
• CAZy Family: GT35
• CAZyme Description: Glycogen phosphorylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
631		72798.48	4.8256

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003755	1072433	MAG	Canada	North America

• Gene Location: Start: 1393; End: 3288 Strand: -

Full Sequence      

MEEGYPFVIRREEEQKLVRYNDLVVRAIPYDMPITGYGTKNVNTLRLWKSEPLEDFDYNA
FNSQKFTEAIVERERVNDICRVLYPNDSTFEGKVLRVRQQYFFCSASLQAIVENELKERG
SLKDFAKYNCMQLNDTHPVLAIPELMRILLDEHNMTWEEAWDIVSHSFAYTNHTVLAEAL
ETWEISIFERLFPRIMEIIYEIDNRFRSELAAAGYHPGKIDYMAPVSGNMVHMAWIACYA
SYSINGVAALHTEILKRDTLHDWHDIWPEKFNNKTNGVTPRRWLDLCNPRLSQLLTELIG
NDSWVRDLDKLQSLESYLEDDTVLTRLNEIKAANKRDFAKWIKQRQGIEINPEAIYDVQI
KRLHEYKRQLMNGLYILDLYFRIKDNPEQKFPPRVFIFGAKAAPGYVRAKAIIKLLNEIA
KLVNNDPVVSQTIKVVFVENYNVSPAEHIIPAADVSEQISTAGKEASGTSNMKFMMNGAL
TLGTMDGANVEIAEAVGKENAYIFGALEEDLPELRRGYNPQAVAEETPGLRRVLDAFTDG
TLSDEGTGIFHDLQLSLLESNGWEEADVYYVLGDFADYRETRDQMAADFYRDRRHWAQMC
WKNIVESGRFSSDRTISDYAEEVWKISPSAI

Enzyme Prediction     

EC	2.4.1.1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT35	2	626	1.1e-224	0.8887240356083086

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK14986	PRK14986	0.0	25	628	211	812	glycogen phosphorylase; Provisional
COG0058	GlgP	0.0	2	628	165	750	Glucan phosphorylase [Carbohydrate transport and metabolism].
PRK14985	PRK14985	0.0	22	625	197	795	maltodextrin phosphorylase; Provisional
TIGR02093	P_ylase	0.0	2	626	154	794	glycogen/starch/alpha-glucan phosphorylases. This family consists of phosphorylases. Members use phosphate to break alpha 1,4 linkages between pairs of glucose residues at the end of long glucose polymers, releasing alpha-D-glucose 1-phosphate. The nomenclature convention is to preface the name according to the natural substrate, as in glycogen phosphorylase, starch phosphorylase, maltodextrin phosphorylase, etc. Name differences among these substrates reflect differences in patterns of branching with alpha 1,6 linkages. Members include allosterically regulated and unregulated forms. A related family, TIGR02094, contains examples known to act well on particularly small alpha 1,4 glucans, as may be found after import from exogenous sources. [Energy metabolism, Biosynthesis and degradation of polysaccharides]
cd04300	GT35_Glycogen_Phosphorylase	0.0	1	626	156	795	glycogen phosphorylase and similar proteins. This is a family of oligosaccharide phosphorylases. It includes yeast and mammalian glycogen phosphorylases, plant starch/glucan phosphorylase, as well as the maltodextrin phosphorylases of bacteria. The members of this family catalyze the breakdown of oligosaccharides into glucose-1-phosphate units. They are important allosteric enzymes in carbohydrate metabolism. The allosteric control mechanisms of yeast and mammalian members of this family are different from that of bacterial members. The members of this family belong to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SDU77540.1	0.0	1	631	160	788
SQH29152.1	0.0	1	631	160	788
ADH92143.1	0.0	1	631	160	788
QCX46304.1	0.0	1	631	160	788
QJC21393.1	0.0	1	631	160	788

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2C4M_A	0.0	2	629	164	791	Starchphosphorylase: structural studies explain oxyanion-dependent kinetic stability and regulatory control. [Corynebacterium callunae],2C4M_B Starch phosphorylase: structural studies explain oxyanion-dependent kinetic stability and regulatory control. [Corynebacterium callunae],2C4M_C Starch phosphorylase: structural studies explain oxyanion-dependent kinetic stability and regulatory control. [Corynebacterium callunae],2C4M_D Starch phosphorylase: structural studies explain oxyanion-dependent kinetic stability and regulatory control. [Corynebacterium callunae]
1Z8D_A	1.03e-192	24	629	221	831	ChainA, Glycogen phosphorylase, muscle form [Homo sapiens]
2GJ4_A	2.37e-192	24	629	209	819	Structureof rabbit muscle glycogen phosphorylase in complex with ligand [Oryctolagus cuniculus]
2GM9_A	2.44e-192	24	629	209	819	Structureof rabbit muscle glycogen phosphorylase in complex with thienopyrrole [Oryctolagus cuniculus],5MCB_A Glycogen phosphorylase in complex with chlorogenic acid. [Oryctolagus cuniculus],7ONF_A Chain A, Glycogen phosphorylase, muscle form [Oryctolagus cuniculus]
7O8E_A	2.84e-192	24	629	214	824	ChainA, Glycogen phosphorylase, muscle form [Oryctolagus cuniculus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P11217	7.04e-193	24	629	221	831	Glycogen phosphorylase, muscle form OS=Homo sapiens OX=9606 GN=PYGM PE=1 SV=6
P79334	3.97e-192	24	629	221	831	Glycogen phosphorylase, muscle form OS=Bos taurus OX=9913 GN=PYGM PE=1 SV=3
Q9WUB3	5.62e-192	24	629	221	831	Glycogen phosphorylase, muscle form OS=Mus musculus OX=10090 GN=Pygm PE=1 SV=3
P73511	6.95e-192	4	631	188	831	Glycogen phosphorylase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) OX=1111708 GN=glgP PE=3 SV=1
O18751	2.24e-191	24	629	221	831	Glycogen phosphorylase, muscle form OS=Ovis aries OX=9940 GN=PYGM PE=2 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000045	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003755_00637.