CAZyme Information: MGYG000003739_01135

Basic Information

• Species: Streptococcus oralis_E
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Streptococcaceae; Streptococcus; Streptococcus oralis_E
• CAZyme ID: MGYG000003739_01135
• CAZy Family: GH8
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
337	MGYG000003739_29|CGC1	38892.85	5.0632

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003739	1855725	MAG	Canada	North America

• Gene Location: Start: 3417; End: 4430 Strand: -

Full Sequence      

MRCVIEFTANGANSSLLQKAVSLMFVRRMILRKRRFLSEAQSYGMLITVLAAQKGQASQA
DFDNLYRYYQNHRIEGTQLMSWKQVITNGSETVEKQNATDGDLYIAYSLIEAAKQWPDKA
QEYQAQAKKILDDILKYNYNEETGVLTVGNWANKDSDYYYLMRTSDTLPHYFQSFYDLTG
NQQWLDVKDKMLGQLEQISSHSDTGLLPDFIWAEKSGARLVDANTIESQYDGAYSYNACR
LPYHLSQSQDERSQKLVQKMMDFFMKEQRIYAGYDLNGTALNQYQAGSFLAPITYASDKG
EGYLKLLQQNKYIFTQDLPLDNYYDATMITMIALEMF

Enzyme Prediction     

No EC number prediction in MGYG000003739_01135.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH8	34	333	1.2e-68	0.909375

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01270	Glyco_hydro_8	1.53e-23	38	334	34	317	Glycosyl hydrolases family 8.
COG3405	BcsZ	2.38e-20	38	266	55	277	Endo-1,4-beta-D-glucanase Y [Carbohydrate transport and metabolism].
PRK11097	PRK11097	1.72e-09	38	143	54	153	cellulase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AQA08566.1	1.37e-219	37	337	67	367
AHZ47396.1	2.77e-219	37	337	67	367
QQL00752.1	5.34e-217	37	337	67	367
QRO06681.1	5.34e-217	37	337	67	367
QLL97167.1	1.53e-216	37	337	67	367

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XD0_A	5.98e-38	38	292	94	359	ApoStructure of Beta-1,3-1,4-glucanase from Paenibacillus sp.X4 [Paenibacillus sp. X4],5XD0_B Apo Structure of Beta-1,3-1,4-glucanase from Paenibacillus sp.X4 [Paenibacillus sp. X4]
1V5C_A	8.78e-27	38	297	73	340	Thecrystal structure of the inactive form chitosanase from Bacillus sp. K17 at pH3.7 [Bacillus sp. (in: Bacteria)],1V5D_A The crystal structure of the active form chitosanase from Bacillus sp. K17 at pH6.4 [Bacillus sp. (in: Bacteria)],1V5D_B The crystal structure of the active form chitosanase from Bacillus sp. K17 at pH6.4 [Bacillus sp. (in: Bacteria)]
7CJU_A	9.98e-27	38	297	79	346	Crystalstructure of inactive form of chitosanase crystallized by ammonium sulfate [Bacillus sp. K17-2],7CJU_B Crystal structure of inactive form of chitosanase crystallized by ammonium sulfate [Bacillus sp. K17-2],7XGQ_A Chain A, chitosanase [Bacillus sp. K17-2],7XGQ_B Chain B, chitosanase [Bacillus sp. K17-2]
6VC5_A	7.30e-12	38	246	33	231	1.6Angstrom Resolution Crystal Structure of endoglucanase from Komagataeibacter sucrofermentans [Komagataeibacter sucrofermentans]
1WZZ_A	1.65e-07	38	244	48	244	Structureof endo-beta-1,4-glucanase CMCax from Acetobacter xylinum [Komagataeibacter xylinus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P19254	3.27e-37	38	292	94	359	Beta-glucanase OS=Niallia circulans OX=1397 GN=bgc PE=3 SV=1
P29019	8.64e-24	38	296	129	395	Endoglucanase OS=Bacillus sp. (strain KSM-330) OX=72575 PE=1 SV=1
P27032	1.53e-08	38	245	52	248	Minor endoglucanase Y OS=Dickeya dadantii (strain 3937) OX=198628 GN=celY PE=1 SV=1
P37696	3.83e-08	38	244	56	252	Probable endoglucanase OS=Komagataeibacter hansenii OX=436 GN=cmcAX PE=1 SV=1
P18336	3.08e-07	38	246	52	249	Endoglucanase OS=Cellulomonas uda OX=1714 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000076	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003739_01135.