CAZyme Information: MGYG000003734_02883

Basic Information

• Species: Afipia broomeae
• Lineage: Bacteria; Proteobacteria; Alphaproteobacteria; Rhizobiales; Xanthobacteraceae; Afipia; Afipia broomeae
• CAZyme ID: MGYG000003734_02883
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase C

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
242	MGYG000003734_49|CGC1	25783.28	8.0946

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003734	5238503	MAG	Canada	North America

• Gene Location: Start: 21662; End: 22390 Strand: +

Full Sequence      

MSPLAKPLRIAMIVTASLVVLTPFTARCETASARVADAVAPWSQFVSEAAERFAIPAAWI
HAVMRVESHGNVKAVSPKGAVGLMQIMPATYAELRERYALGGDPFDPHDNIVAGAAYLRE
MHDRFGTSGFVAAYNVGPTRYEDHLATGRPLPDETRNYVASLAPLLSDAQTGDNAIAAGE
PNTWRGASLFVSRSQRKSSDTRMSFTPQSSPVGHDRGAVDLSALTPLPGGLFVKQAPTPG
KP

Enzyme Prediction     

No EC number prediction in MGYG000003734_02883.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	44	162	8.2e-27	0.837037037037037

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd00254	LT-like	9.01e-40	57	160	1	104	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	3.61e-33	41	159	5	139	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
cd16896	LT_Slt70-like	3.40e-30	41	159	3	137	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
pfam01464	SLT	1.53e-28	48	138	3	96	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
COG0741	MltE	3.76e-22	29	159	122	273	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SHJ95748.1	7.22e-71	41	236	99	293
CCG08220.1	7.53e-69	41	240	114	313
ABQ39295.1	4.07e-67	46	233	1	188
ARN82492.1	5.30e-67	8	242	1	238
ACI52536.1	1.06e-66	41	233	36	229

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1QSA_A	3.12e-11	55	162	466	591	CrystalStructure Of The 70 Kda Soluble Lytic Transglycosylase Slt70 From Escherichia Coli At 1.65 Angstroms Resolution [Escherichia coli],1QTE_A Crystal Structure Of The 70 Kda Soluble Lytic Transglycosylase Slt70 From Escherichia Coli At 1.90 A Resolution In Complex With A 1,6- Anhydromurotripeptide [Escherichia coli]
1SLY_A	6.14e-10	55	162	466	591	ComplexOf The 70-Kda Soluble Lytic Transglycosylase With Bulgecin A [Escherichia coli]
5MPQ_A	7.23e-07	39	140	413	517	BulgecinA: The key to a broad-spectrum inhibitor that targets lytic transglycosylases [Neisseria meningitidis]
5O1J_A	7.25e-07	39	140	417	521	Lytictransglycosylase in action [Neisseria meningitidis MC58]
6FPN_B	7.27e-07	39	140	423	527	Lytictransglycosylase in action [Neisseria meningitidis MC58]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31608	9.66e-16	46	162	64	175	Putative murein lytic transglycosylase YjbJ OS=Bacillus subtilis (strain 168) OX=224308 GN=yjbJ PE=3 SV=1
O31976	2.92e-13	42	162	1422	1537	SPbeta prophage-derived uncharacterized transglycosylase YomI OS=Bacillus subtilis (strain 168) OX=224308 GN=yomI PE=3 SV=2
O64046	2.92e-13	42	162	1422	1537	Probable tape measure protein OS=Bacillus phage SPbeta OX=66797 GN=yomI PE=3 SV=1
P0AGC3	1.73e-10	55	162	493	618	Soluble lytic murein transglycosylase OS=Escherichia coli (strain K12) OX=83333 GN=slt PE=1 SV=1
P0AGC4	1.73e-10	55	162	493	618	Soluble lytic murein transglycosylase OS=Escherichia coli O157:H7 OX=83334 GN=slt PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000261	0.137378	0.862158	0.000068	0.000075	0.000055

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003734_02883.