CAZyme Information: MGYG000003734_02719

Basic Information

• Species: Afipia broomeae
• Lineage: Bacteria; Proteobacteria; Alphaproteobacteria; Rhizobiales; Xanthobacteraceae; Afipia; Afipia broomeae
• CAZyme ID: MGYG000003734_02719
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
682	MGYG000003734_44|CGC1	75531.2	8.8705

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003734	5238503	MAG	Canada	North America

• Gene Location: Start: 33984; End: 36032 Strand: -

Full Sequence      

MAWGSGLMAVAGRASEVDGARPQRFASLTASARNLTSYIAGLLGPPPSQNDNRPGIREPG
PAVELDCLRHLFAPSLIAAAERRSNEIGVGAERVLIQWGVISEDAYLDQLAIHTGLQIET
LDDLSLADCLLPHDGLHLCARHGILPIRQRGELAYVSAPHGYTARRIIRLITEYPSLLPR
VRLASTARFNAFLENQSGNILARTAAENLVTRFPPLSAAPVPASSSRLFRFGRHLLRLAA
PVALLTLAPMLVIDTFGLILAIWFLLFTSLRLAGGLSPPKRRRQRPRLPDSQLPIYTVIA
ALYREASSVAPLMQYIGALDYPPEKLDIKLVIETDDPETRAAIARLGSMPHVQVIIAPDV
GPRTKPKALNCALNFARGTFITVFDAEDRPEPGQLREALDVFRTYGPEVACAQASLCIDN
TADGWIPRMFTAEYAGQFDVFLQGFSNFEMPLPLGGSSNHFRTSVLREVGGWDPYNVTED
ADLGFRLARFRYRCVMFPSTTYEEAPARFTAWLRQRSRWMKGWMQTWSVHMRSPRKLWRD
AGAGGFFTLNIIVGGNVLTALAHPFLLGELLVRGVMSAFDDSVASFFAKPFIELYLATIA
AGYLTTIVIGVIGLAKRNLLREAWVLALTPVYWIFLSLAAWRALYQLLTEPYHWEKTEHG
LAQTSRMSVGRSQPDGMRDQSD

Enzyme Prediction     

No EC number prediction in MGYG000003734_02719.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	381	574	1.2e-27	0.7614213197969543

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06427	CESA_like_2	4.22e-128	294	534	1	241	CESA_like_2 is a member of the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, Glucan Biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of glucan.
COG1215	BcsA	9.19e-45	244	647	6	409	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
cd06423	CESA_like	2.37e-36	298	480	1	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
cd06421	CESA_CelA_like	2.47e-24	297	526	20	233	CESA_CelA_like are involved in the elongation of the glucan chain of cellulose. Family of proteins related to Agrobacterium tumefaciens CelA and Gluconacetobacter xylinus BscA. These proteins are involved in the elongation of the glucan chain of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues. They are putative catalytic subunit of cellulose synthase, which is a glycosyltransferase using UDP-glucose as the substrate. The catalytic subunit is an integral membrane protein with 6 transmembrane segments and it is postulated that the protein is anchored in the membrane at the N-terminal end.
pfam13632	Glyco_trans_2_3	7.44e-23	380	572	1	194	Glycosyl transferase family group 2. Members of this family of prokaryotic proteins include putative glucosyltransferases, which are involved in bacterial capsule biosynthesis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEI07958.1	8.96e-233	22	668	14	654
AEI04328.1	8.96e-233	22	668	14	654
ACI91808.1	8.96e-233	22	668	14	654
ABE38236.1	1.65e-211	62	666	54	654
QDM29947.1	1.23e-209	21	673	10	654

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P96587	1.20e-11	292	522	47	279	Uncharacterized glycosyltransferase YdaM OS=Bacillus subtilis (strain 168) OX=224308 GN=ydaM PE=3 SV=1
P74165	4.30e-10	277	532	94	345	Beta-monoglucosyldiacylglycerol synthase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) OX=1111708 GN=sll1377 PE=1 SV=1
Q7XIF5	7.63e-08	316	522	168	384	Probable glucomannan 4-beta-mannosyltransferase 7 OS=Oryza sativa subsp. japonica OX=39947 GN=CSLA7 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.998170	0.001835	0.000004	0.000003	0.000002	0.000003

TMHMM  Annotations     

start	end
245	267
545	567
592	614
623	645