CAZyme Information: MGYG000003717_01583

Basic Information

• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Streptococcaceae; Streptococcus
• CAZyme ID: MGYG000003717_01583
• CAZy Family: CBM71
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1565		171261.06	5.1235

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003717	1753680	MAG	Canada	North America

• Gene Location: Start: 30; End: 4727 Strand: +

Full Sequence      

MVHLLPHWNWENRELASKVEDSDGKIPVRAYSNAASVELFLNGKSLGVKKFNKKQTSDGR
TYQEGANAKELYLEWKVAYQPGTLEAVARDEAGKEIARDKITTAGQPAGVRLVKEEHAIA
ADGKDLTYIYYEIVDSEGNVVPTANNLVRFQLHGQGQLVGVDNGEQASRERYKAQPDGSW
IRRAFNGKGVAIVKSTEQAGKFTLTAHSDLLKSGQVTVFTGKKEDQEKTVLGTEVPKVRT
VIEKEPKMPKTVGFIYSDGSREKRPVTWSSVDVSQAGVVTVKGMADGREVEARVEILAIA
NELPTVKRVAPGTDLSAVDKYVSIAVTDGSVQEYEVDKWEISEADKAKLSVAGSRIQMTG
QLGGETIHATLVVEEGNPAAPAIPTVTVGGESVTGLTSQNPMQYRTLAYGAQLPEVAASA
ENAAVTVVQASAANGMRASIFVQPNDGGPLQMYAIQFLEEAPKIDHLSLQVEQADGLKED
QTVKLSILAHYQDGTQAVLPADKVNFSTSGEGEVAVRKGMLELHKPGTVTLKAEYEGATG
QIALTIQANTETKVAQSIRPVNVVTDLHQEPTLPATVTVEYDKGFPKAHKVIWQAIPKEK
LDHYQTFEVLGKVEGLDLEARAKVSVEGIVSVEEVSVTTPISEAPQLPESVRTYDSNGHV
SSAKVTWDTIRPEQYAKEGVFTVNGHLEGTQLTTKLHVRVSAQTEKGANISDQWTGSELP
LAFASDSNPTDPVSNVNDKLISFNDRPANRWTNWNRTNPEASVGVLFGDSGILSKRSVDN
LSVGFHEDHGVGVPKSYVIEYYVGKTVPTAPKNPSFVGEENHAFNDPANWKEVSNLKAPA
QLKAGEMNHFSFDKVETYAVRIRMVRLDSKKGTSITEVQIFAKQVAAAKQGQTRIQVDGK
NLANFNPDLTDYYLESVDGKVPAVTASVSNNGLATVVPSVREGEPVRVIAKAENGDILGE
YRLHFTSNKDLLSRKPVAAVKQARLLQVGQPLELPTKVPVYFTGKDGYETKDLAVEWEEV
PAENLTNAGQFTVRGRVLGSDLVAEFTVRVTDKLGEALSNNPEYDENSNRAFASATNDID
RNSHDRVDYLNDGNHSENRRWTNWSPTPSSNPEVSAGVIFRENGKIVERTVAQAKLHFFA
DSGTDAPSKLVLERYIGPDFEVPTYYSNYQAYDAGHPFNNPENWEAVPYRADKDIAAGDE
INVTFKAVKAKAMRWRMERKADKSGVAMIEMTFLAPSELPQESTQSKILVDGKELPDFAE
DRQDYQITYKGQRPKVSVEESNQVASTVVDSGDDSLPVLVRLVSESGKQVKEYRIQLTKE
KPVSEKTVAAVQEELPKLEFVEKDLAYKTVEKKDSTLYLGETRVEQEGKVGKERIFTAVN
PSGSKEEKLREVVEAPTDRIVLVGTKPGTSLPEDEVKNLVLNLPELISEEEIIDFKVQEQ
KNDKLPAGQTRILQEGRQGIRVHLIEVENGKRTEKESYDKVMAQDRIVEVGTASETTKPV
PQESTKPQVSEKADTKKIVSSEASHVQEEQLPNTGSAESQAALAAGLALLGLSAGLVATK
GKKED

Enzyme Prediction     

No EC number prediction in MGYG000003717_01583.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM71	708	905	6.3e-90	0.9902439024390244
CBM71	1057	1258	8.3e-85	0.9902439024390244

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam18565	Glyco_hydro2_C5	4.05e-33	111	217	2	103	Glycoside hydrolase family 2 C-terminal domain 5. Domain 5 is found in dimeric beta-D-galactosidase from Paracoccus sp. 32d, which contributes to stabilization of the functional dimer. It is suggested that the location of this domain 5, may be one of the factors responsible for the creation of a functional dimer and cold-adaptation of this enzyme.
pfam16355	DUF4982	4.59e-21	25	99	3	62	Domain of unknown function (DUF4982). This family is found in the C-terminal of uncharacterized proteins and beta-galactosidases around 680 residues in length from various Bacteroides species. The function of this protein is unknown.
pfam07501	G5	1.58e-10	1341	1406	6	75	G5 domain. This domain is found in a wide range of extracellular proteins. It is found tandemly repeated in up to 8 copies. It is found in the N-terminus of peptidases belonging to the M26 family which cleave human IgA. The domain is also found in proteins involved in metabolism of bacterial cell walls suggesting this domain may have an adhesive function.
pfam07532	Big_4	1.20e-09	632	690	1	59	Bacterial Ig-like domain (group 4). This family consists of bacterial domains with an Ig-like fold. Members of this family are found in a variety of bacterial surface proteins.
pfam07501	G5	9.75e-09	1425	1493	2	75	G5 domain. This domain is found in a wide range of extracellular proteins. It is found tandemly repeated in up to 8 copies. It is found in the N-terminus of peptidases belonging to the M26 family which cleave human IgA. The domain is also found in proteins involved in metabolism of bacterial cell walls suggesting this domain may have an adhesive function.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QLL99025.1	0.0	1	1565	761	2325
ANR76178.1	0.0	1	1565	761	2326
QXW62013.1	0.0	1	1565	761	2412
CBZ00361.1	0.0	1	1565	761	2325
QLL97214.1	0.0	1	1565	761	2412

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4CU6_A	2.47e-129	1	224	625	848	Unravellingthe multiple functions of the architecturally intricate Streptococcus pneumoniae beta-galactosidase, BgaA [Streptococcus pneumoniae TIGR4],4CU7_A Unravelling the multiple functions of the architecturally intricate Streptococcus pneumoniae beta-galactosidase, BgaA [Streptococcus pneumoniae TIGR4],4CU8_A Unravelling the multiple functions of the architecturally intricate Streptococcus pneumoniae beta-galactosidase, BgaA [Streptococcus pneumoniae TIGR4]
4CUC_A	2.47e-129	1	224	625	848	Unravellingthe multiple functions of the architecturally intricate Streptococcus pneumoniae beta-galactosidase, BgaA. [Streptococcus pneumoniae TIGR4]
4CU9_A	2.94e-112	1061	1238	9	186	Unravellingthe multiple functions of the architecturally intricate Streptococcus pneumoniae beta-galactosidase, BgaA [Streptococcus pneumoniae],4CU9_B Unravelling the multiple functions of the architecturally intricate Streptococcus pneumoniae beta-galactosidase, BgaA [Streptococcus pneumoniae]
4CUB_A	1.23e-110	703	885	1	183	Unravellingthe multiple functions of the architecturally intricate Streptococcus pneumoniae beta-galactosidase, BgaA [Streptococcus pneumoniae],4CUB_B Unravelling the multiple functions of the architecturally intricate Streptococcus pneumoniae beta-galactosidase, BgaA [Streptococcus pneumoniae]
4CUA_A	5.72e-109	703	885	1	183	Unravellingthe multiple functions of the architecturally intricate Streptococcus pneumoniae beta-galactosidase, BgaA [Streptococcus pneumoniae],4CUA_B Unravelling the multiple functions of the architecturally intricate Streptococcus pneumoniae beta-galactosidase, BgaA [Streptococcus pneumoniae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A7LXS9	2.13e-34	1	218	659	846	Beta-galactosidase BoGH2A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02645 PE=1 SV=1
T2KM09	6.56e-13	1	164	626	768	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22050 PE=2 SV=2
P77989	2.22e-08	3	208	539	725	Beta-galactosidase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) OX=340099 GN=lacZ PE=3 SV=2
P49610	4.63e-06	1399	1491	1035	1135	Beta-N-acetylhexosaminidase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=strH PE=1 SV=2
Q54875	6.45e-06	1327	1492	230	391	Immunoglobulin A1 protease OS=Streptococcus pneumoniae OX=1313 GN=iga PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000052	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003717_01583.