CAZyme Information: MGYG000003714_02253

Basic Information

• Species: Enterococcus_A gilvus
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Enterococcaceae; Enterococcus_A; Enterococcus_A gilvus
• CAZyme ID: MGYG000003714_02253
• CAZy Family: GH1
• CAZyme Description: 6-phospho-beta-glucosidase BglA

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
474	MGYG000003714_121|CGC1	54348.27	4.4611

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003714	3507168	MAG	Russia	Europe

• Gene Location: Start: 3692; End: 5116 Strand: +

Full Sequence      

MTFKKDFLWGGSIAAHQCEGAWQEAGKGPAIMDFVTKGSNNEPRMITETIDPKLDYPSHL
GIDFYHHYKEDIQLFKEIGFNALRISIDWSRIFPKGDEQVPNQGGLDFYEQVIDELLANN
IEPIVTLYHFELPIHLVCEYGSWKNRQVIDFYLQYCETVMRAYDGKVKYWVTFNEMNHLD
PQSEQSDIFTYLIAGLKYSEMENPTEDLARIGYNMTLAGVKAARLGREINSNNIIGCVFG
LNPIYSYDCQPDNVLKGFLDNDKDYYQVDAMCNGKFPKYKMKQYEALDIDLENQSSDVED
FAKGTIDFIGLNYYMSSISEPNTPVEAETALFGGIQNPHLEQSKWGWGIDPIGIRFVMNL
LYRKYELPIMITENGLGAVDQLEEGTVHDDYRIDYLQKHIKAVKQAVEEDYVECIGYLTW
GPIDLVSASTGEMSKRYGFIYVDLDNEGKGSLHRSKKDSFGWFQNVIKSNGEEL

Enzyme Prediction     

EC	3.2.1.86	3.2.1.21	3.2.1.37

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	2	471	1.6e-133	0.9883449883449883

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG2723	BglB	0.0	1	473	2	456	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
PRK09589	celA	0.0	1	474	2	476	6-phospho-beta-glucosidase; Reviewed
PRK09852	PRK09852	9.43e-170	2	474	3	473	cryptic 6-phospho-beta-glucosidase; Provisional
PRK15014	PRK15014	1.21e-169	1	474	4	477	6-phospho-beta-glucosidase BglA; Provisional
PRK09593	arb	6.94e-169	1	474	4	477	6-phospho-beta-glucosidase; Reviewed

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AXG40595.1	0.0	1	474	1	474
BBM17440.1	0.0	1	474	1	474
AYQ26138.1	0.0	1	474	1	474
QCQ14168.1	0.0	1	474	1	474
AXU32943.1	1.40e-260	1	474	1	475

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2XHY_A	1.68e-165	1	474	6	479	CrystalStructure of E.coli BglA [Escherichia coli K-12],2XHY_B Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_C Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_D Crystal Structure of E.coli BglA [Escherichia coli K-12]
4F66_A	1.12e-158	5	474	9	480	Thecrystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans],4F66_B The crystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans]
4F79_A	3.20e-158	5	474	9	480	Thecrystal structure of 6-phospho-beta-glucosidase mutant (E375Q) in complex with Salicin 6-phosphate [Streptococcus mutans],4GPN_A The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159],4GPN_B The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159]
3PN8_A	2.74e-154	5	474	9	480	Thecrystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 [Streptococcus mutans],3PN8_B The crystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 [Streptococcus mutans]
3QOM_A	3.17e-148	2	474	10	480	Crystalstructure of 6-phospho-beta-glucosidase from Lactobacillus plantarum [Lactiplantibacillus plantarum],4GZE_A Chain A, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_B Chain B, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_C Chain C, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_D Chain D, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_E Chain E, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_F Chain F, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q46829	9.18e-165	1	474	6	479	6-phospho-beta-glucosidase BglA OS=Escherichia coli (strain K12) OX=83333 GN=bglA PE=1 SV=2
P42973	1.05e-163	5	474	6	479	Aryl-phospho-beta-D-glucosidase BglA OS=Bacillus subtilis (strain 168) OX=224308 GN=bglA PE=1 SV=1
P40740	1.07e-145	3	474	8	469	Aryl-phospho-beta-D-glucosidase BglH OS=Bacillus subtilis (strain 168) OX=224308 GN=bglH PE=1 SV=2
P24240	1.73e-140	2	474	3	473	6-phospho-beta-glucosidase AscB OS=Escherichia coli (strain K12) OX=83333 GN=ascB PE=3 SV=2
Q46130	1.91e-139	1	474	5	471	6-phospho-beta-glucosidase OS=Clostridium longisporum OX=1523 GN=abgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000053	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003714_02253.