CAZyme Information: MGYG000003712_02251

Basic Information

• Species: Serratia liquefaciens
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Serratia; Serratia liquefaciens
• CAZyme ID: MGYG000003712_02251
• CAZy Family: AA10
• CAZyme Description: GlcNAc-binding protein A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
197	MGYG000003712_47|CGC1	21581.01	7.3721

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003712	5062001	MAG	Estonia	Europe

• Gene Location: Start: 1307; End: 1900 Strand: -

Full Sequence      

MNNTSRTLMSLGLLSAALFGVSQQAAAHGYVETPASRSYQCKLQLNTQCGSVQYEPQSVE
GLKGFPQAGPADGHIASADKSTFFELDQQTPTRWNKINLHTGANSFTWRLTARHSTTSWR
YFITKPNWDASQPLTRASFDLTPFCQQNDGGAIPAAQVTHQCNIPADRSGSHVILAVWDV
ADTTNAFYQAIDVNLTK

Enzyme Prediction     

EC	1.-.-.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA10	28	194	1.2e-60	0.9943820224719101

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK13211	PRK13211	3.28e-102	13	196	9	194	N-acetylglucosamine-binding protein GbpA.
COG3397	COG3397	3.49e-81	8	194	10	206	Predicted carbohydrate-binding protein, contains CBM5 and CBM33 domains [General function prediction only].
cd21177	LPMO_AA10	1.30e-74	28	194	1	180	lytic polysaccharide monooxygenase (LPMO) auxiliary activity family 10 (AA10). AA10 proteins are copper-dependent lytic polysaccharide monooxygenases (LPMOs), which may act on chitin or cellulose. The family used to be called CBM33. Activities in this family include lytic cellulose monooxygenase (C1-hydroxylating) (EC 1.14.99.54), lytic cellulose monooxygenase (C4-dehydrogenating) (EC 1.14.99.56), lytic chitin monooxygenase (EC 1.14.99.53), and lytic xylan monooxygenase/xylan oxidase (glycosidic bond-cleaving) (EC 1.14.99.-). Also included are viral chitin-binding glycoproteins such as fusolin and spheroidin-like proteins.
pfam03067	LPMO_10	1.12e-66	28	193	1	186	Lytic polysaccharide mono-oxygenase, cellulose-degrading. This domain is found associated with a wide variety of cellulose binding domains. This is a family of two very closely related proteins that together act as both a C1- and a C4-oxidising lytic polysaccharide mono-oxygenase, degrading cellulose. This domain is also found in baculoviral spheroidins and spindolins, protein of unknown function.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNQ53218.1	6.03e-146	1	197	1	197
AKE09399.1	6.03e-146	1	197	1	197
AYO39246.1	6.03e-146	1	197	1	197
AMH01131.1	6.03e-146	1	197	1	197
AGQ32269.1	6.03e-146	1	197	1	197

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2BEM_A	2.47e-122	28	197	1	170	Crystalstructure of the Serratia marcescens chitin-binding protein CBP21 [Serratia marcescens],2BEM_B Crystal structure of the Serratia marcescens chitin-binding protein CBP21 [Serratia marcescens],2BEM_C Crystal structure of the Serratia marcescens chitin-binding protein CBP21 [Serratia marcescens],2LHS_A Structure of the chitin binding protein 21 (CBP21) [Serratia marcescens]
2BEN_A	5.81e-121	28	197	1	170	Crystalstructure of the Serratia marcescens chitin-binding protein CBP21 Y54A mutant. [Serratia marcescens],2BEN_B Crystal structure of the Serratia marcescens chitin-binding protein CBP21 Y54A mutant. [Serratia marcescens]
5WSZ_A	7.87e-75	28	195	1	166	Crystalstructure of a lytic polysaccharide monooxygenase,BtLPMO10A, from Bacillus thuringiensis [Bacillus thuringiensis serovar kurstaki],5WSZ_B Crystal structure of a lytic polysaccharide monooxygenase,BtLPMO10A, from Bacillus thuringiensis [Bacillus thuringiensis serovar kurstaki],5WSZ_C Crystal structure of a lytic polysaccharide monooxygenase,BtLPMO10A, from Bacillus thuringiensis [Bacillus thuringiensis serovar kurstaki],5WSZ_D Crystal structure of a lytic polysaccharide monooxygenase,BtLPMO10A, from Bacillus thuringiensis [Bacillus thuringiensis serovar kurstaki]
6T5Z_A	5.01e-60	28	196	1	172	Crystalstructure of an AA10 LPMO from Photorhabdus luminescens [Photorhabdus laumondii subsp. laumondii TTO1],6T5Z_B Crystal structure of an AA10 LPMO from Photorhabdus luminescens [Photorhabdus laumondii subsp. laumondii TTO1],6T5Z_C Crystal structure of an AA10 LPMO from Photorhabdus luminescens [Photorhabdus laumondii subsp. laumondii TTO1]
5L2V_A	5.57e-55	28	195	1	164	Catalyticdomain of LPMO Lmo2467 from Listeria monocytogenes [Listeria monocytogenes 10403S],5L2V_B Catalytic domain of LPMO Lmo2467 from Listeria monocytogenes [Listeria monocytogenes 10403S]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8EHY2	5.49e-72	4	197	5	197	GlcNAc-binding protein A OS=Shewanella oneidensis (strain MR-1) OX=211586 GN=gbpA PE=3 SV=2
Q7MEW9	7.11e-57	13	193	9	198	GlcNAc-binding protein A OS=Vibrio vulnificus (strain YJ016) OX=196600 GN=gbpA PE=3 SV=1
Q8D7V4	3.89e-56	13	193	9	198	GlcNAc-binding protein A OS=Vibrio vulnificus (strain CMCP6) OX=216895 GN=gbpA PE=3 SV=1
Q87FT0	6.13e-55	13	193	9	199	GlcNAc-binding protein A OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) OX=223926 GN=gbpA PE=3 SV=1
A7N3J0	1.95e-52	6	193	2	199	GlcNAc-binding protein A OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) OX=1224742 GN=gbpA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000262	0.999046	0.000184	0.000183	0.000157	0.000140

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003712_02251.