CAZyme Information: MGYG000003712_01278

Basic Information

• Species: Serratia liquefaciens
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Serratia; Serratia liquefaciens
• CAZyme ID: MGYG000003712_01278
• CAZy Family: GH19
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
203	MGYG000003712_19|CGC2	22361.36	9.9617

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003712	5062001	MAG	Estonia	Europe

• Gene Location: Start: 37459; End: 38070 Strand: -

Full Sequence      

MTQDQFQQAADTSADLAARWFKPITAAMAEFGITTPVQQAMFIAQTGHESLGFKRLAESF
DYTPAALQATFGSRISRDQAAMLGRTADHPARQEAIANLVYQGRYGNKLPGDGWKFRGHG
LIQITFLDNHKACGKALGLDLVANPELLMADVNAARSAGWYWRSRNINQVVGDITESTRR
INPALHALGQRETRYKRAIAVLA

Enzyme Prediction     

No EC number prediction in MGYG000003712_01278.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH19	31	167	4.5e-31	0.45454545454545453

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3179	COG3179	5.12e-63	1	203	4	205	Predicted chitinase [General function prediction only].
pfam00182	Glyco_hydro_19	2.54e-08	40	162	54	154	Chitinase class I.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AGQ28734.1	7.79e-136	1	203	1	203
AMH01859.1	3.17e-135	1	203	1	203
AVE48215.1	2.68e-127	1	203	1	203
SAY43454.1	6.31e-126	1	203	1	203
AEF50770.1	7.36e-125	1	202	1	202

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4OK7_A	1.44e-59	4	203	19	223	ChainA, Endolysin [Salmonella phage SPN1S],4OK7_B Chain B, Endolysin [Salmonella phage SPN1S],4OK7_C Chain C, Endolysin [Salmonella phage SPN1S]
1WVU_A	1.91e-07	116	189	152	235	Crystalstructure of chitinase C from Streptomyces griseus HUT6037 [Streptomyces griseus],1WVU_B Crystal structure of chitinase C from Streptomyces griseus HUT6037 [Streptomyces griseus],2DBT_A Crystal structure of chitinase C from Streptomyces griseus HUT6037 [Streptomyces griseus],2DBT_B Crystal structure of chitinase C from Streptomyces griseus HUT6037 [Streptomyces griseus],2DBT_C Crystal structure of chitinase C from Streptomyces griseus HUT6037 [Streptomyces griseus]
1WVV_A	1.91e-07	116	189	152	235	ChainA, chitinase C [Streptomyces griseus],1WVV_B Chain B, chitinase C [Streptomyces griseus]
2CJL_A	2.33e-07	110	165	85	141	CrystalStructure And Enzymatic Properties Of A Bacterial Family 19 Chitinase Reveal Differences With Plant Enzymes [Streptomyces coelicolor],2CJL_B Crystal Structure And Enzymatic Properties Of A Bacterial Family 19 Chitinase Reveal Differences With Plant Enzymes [Streptomyces coelicolor]
4MST_A	5.77e-07	113	162	105	155	CrystalStructure of a putative catalytic domain of a chitinase-like protein (HbCLP1) from Hevea brasiliensis [Hevea brasiliensis],4MST_B Crystal Structure of a putative catalytic domain of a chitinase-like protein (HbCLP1) from Hevea brasiliensis [Hevea brasiliensis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P44187	5.97e-27	21	196	22	192	Glycosyl hydrolase family 19 domain-containing protein HI_1415 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=HI_1415 PE=3 SV=1
O64203	1.03e-07	34	201	213	360	Endolysin A OS=Mycobacterium phage D29 OX=28369 GN=10 PE=1 SV=1
P42820	6.26e-07	113	192	181	261	Acidic endochitinase SP2 OS=Beta vulgaris OX=161934 GN=SP2 PE=1 SV=1
Q05538	1.26e-06	40	162	129	229	Basic 30 kDa endochitinase OS=Solanum lycopersicum OX=4081 GN=CHI9 PE=1 SV=1
Q7XCK6	1.40e-06	75	169	84	182	Chitinase 8 OS=Oryza sativa subsp. japonica OX=39947 GN=Cht8 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000040	0.000002	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003712_01278.