CAZyme Information: MGYG000003701_02620

Basic Information

• Species: Parabacteroides sp003480915
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Tannerellaceae; Parabacteroides; Parabacteroides sp003480915
• CAZyme ID: MGYG000003701_02620
• CAZy Family: GH33
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
540	MGYG000003701_5|CGC13	59641.91	6.7743

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003701	6084075	Isolate	China	Asia

• Gene Location: Start: 293777; End: 295399 Strand: +

Full Sequence      

MKKSIFYLCLLFIVQTAIAADSLYVREQQIPILIDRTDNVLLEMRIPAQKGDILNKLTLQ
FGNETNTSDIKAVRLFYSGVEAPSREGTHFSPITYITGFTRRNSQAANPSYSVKQDEVTA
PGNTITLTSKQPMVKGTNYYWVSIEMKPETSLLSKVSFTLPEAVINNKPMEITWSGKAES
PRRVGVGVRQGGDDGSAAFRIPGLVTTNNGTLLGVYDIRYNSSVDLQEMVDIGVSRSTDK
GQTWEPMRVAMTFGETGGLPHAQNGVGDPSILVDEKTNTIWIVAAWTHGMGNGRAWWNSM
PGMTPDETAQLMLVKSEDDGKTWSEPINITSQVKDPSWYFLLQGPGRGITMQDGTLVFPI
QFIDATRIPNAGVMYSKDRGKTWHLHNLARTNTTEAQVAEVEPGVLMLNMRDNRGGSRAV
AITKDLGKTWTEHPSNRSALQEPVCMASLIKVDAKDNITGKKLLLFSNPNTTKGRNHITI
KASLDGGLTWPAEHQVLLDEAEGWGYSCLSMIDKETVGIFYESSVAHMTFQAIRITDLIK

Enzyme Prediction     

EC	3.2.1.18

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH33	189	526	5.1e-96	0.9327485380116959

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd15482	Sialidase_non-viral	2.04e-100	191	523	6	324	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
pfam14873	BNR_assoc_N	7.41e-51	20	169	1	149	N-terminal domain of BNR-repeat neuraminidase. This domain is usually found at the N-terminus of the BNR-repeat neuraminidase protein family.
pfam13859	BNR_3	1.40e-24	201	475	1	254	BNR repeat-like domain. This family of proteins contains BNR-like repeats suggesting these proteins may act as sialidases.
pfam13088	BNR_2	5.02e-24	230	507	18	266	BNR repeat-like domain. This family of proteins contains BNR-like repeats suggesting these proteins may act as sialidases.
COG4409	NanH	2.01e-18	191	522	267	643	Neuraminidase (sialidase) [Carbohydrate transport and metabolism, Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUR48260.1	0.0	1	539	1	539
QIX64920.1	0.0	1	539	1	539
BBK92944.1	0.0	1	539	22	560
QUT52021.1	0.0	1	539	1	539
QJE29687.1	0.0	1	539	1	539

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4FJ6_A	0.0	20	539	2	521	Crystalstructure of a glycoside hydrolase family 33, candidate sialidase (BDI_2946) from Parabacteroides distasonis ATCC 8503 at 1.90 A resolution [Parabacteroides distasonis ATCC 8503],4FJ6_B Crystal structure of a glycoside hydrolase family 33, candidate sialidase (BDI_2946) from Parabacteroides distasonis ATCC 8503 at 1.90 A resolution [Parabacteroides distasonis ATCC 8503],4FJ6_C Crystal structure of a glycoside hydrolase family 33, candidate sialidase (BDI_2946) from Parabacteroides distasonis ATCC 8503 at 1.90 A resolution [Parabacteroides distasonis ATCC 8503],4FJ6_D Crystal structure of a glycoside hydrolase family 33, candidate sialidase (BDI_2946) from Parabacteroides distasonis ATCC 8503 at 1.90 A resolution [Parabacteroides distasonis ATCC 8503]
6MRV_A	6.17e-269	1	540	1	543	Sialidase26co-crystallized with DANA [bacterium],6MRV_B Sialidase26 co-crystallized with DANA [bacterium],6MRX_A Sialidase26 apo [bacterium],6MRX_B Sialidase26 apo [bacterium],6MRX_C Sialidase26 apo [bacterium],6MRX_D Sialidase26 apo [bacterium]
6MYV_A	3.09e-267	20	540	1	522	Sialidase26co-crystallized with DANA-Gc [bacterium],6MYV_B Sialidase26 co-crystallized with DANA-Gc [bacterium],6MYV_C Sialidase26 co-crystallized with DANA-Gc [bacterium],6MYV_D Sialidase26 co-crystallized with DANA-Gc [bacterium]
4Q6K_A	1.69e-259	18	540	2	525	Crystalstructure of a putative neuraminidase (BACCAC_01090) from Bacteroides caccae ATCC 43185 at 1.90 A resolution (PSI Community Target) [Bacteroides caccae ATCC 43185],4Q6K_B Crystal structure of a putative neuraminidase (BACCAC_01090) from Bacteroides caccae ATCC 43185 at 1.90 A resolution (PSI Community Target) [Bacteroides caccae ATCC 43185],4Q6K_C Crystal structure of a putative neuraminidase (BACCAC_01090) from Bacteroides caccae ATCC 43185 at 1.90 A resolution (PSI Community Target) [Bacteroides caccae ATCC 43185],4Q6K_D Crystal structure of a putative neuraminidase (BACCAC_01090) from Bacteroides caccae ATCC 43185 at 1.90 A resolution (PSI Community Target) [Bacteroides caccae ATCC 43185]
6MNJ_A	8.93e-256	1	540	2	539	Hadzamicrobial sialidase Hz136 [Alistipes],6MNJ_B Hadza microbial sialidase Hz136 [Alistipes]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P31206	1.69e-261	1	540	1	544	Sialidase OS=Bacteroides fragilis (strain YCH46) OX=295405 GN=nanH PE=3 SV=2
P15698	5.62e-38	199	524	54	382	Sialidase OS=Paeniclostridium sordellii OX=1505 PE=1 SV=1
P29767	1.65e-34	51	522	255	809	Sialidase OS=Clostridium septicum OX=1504 PE=3 SV=1
P10481	5.96e-32	196	524	33	364	Sialidase OS=Clostridium perfringens OX=1502 GN=nanH PE=1 SV=1
Q02834	9.08e-32	192	522	60	386	Sialidase OS=Micromonospora viridifaciens OX=1881 GN=nedA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000218	0.999177	0.000161	0.000145	0.000141	0.000136

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003701_02620.