CAZyme Information: MGYG000003701_01504

Basic Information

• Species: Parabacteroides sp003480915
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Tannerellaceae; Parabacteroides; Parabacteroides sp003480915
• CAZyme ID: MGYG000003701_01504
• CAZy Family: GH97
• CAZyme Description: Retaining alpha-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
625	MGYG000003701_2|CGC10	70258.09	7.0757

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003701	6084075	Isolate	China	Asia

• Gene Location: Start: 684659; End: 686536 Strand: -

Full Sequence      

MKKTISLLFCALLQPLLLSAQTLLPLVSPSETLNAKIQVDGTSVRIGLYEKGDQVVDVKT
LQLNLEENTLAGNWLVTNQKRNEVNQTWKPVYGERSLITDRYNELKLTLRSDANQKEMTL
EVRLYDEGLAFRYAFDKLDFWNQTLLNEKTQFLFKEDCKTWVTGMAQGAYSEKRLSTLSG
AADRPQVIQVNDHRFVAIGEAALVDYSRMKLEKSETGFGVQSVLSGKVNLDLADYQSPWR
YVMVAEHPGKLVEHNYFVLNLNEPNQIANTSWIKPGQVLREVTLTTAGSLACIDFAAENN
IAYVLFDAGWYGAEEDMKSDATTVTIDPARSKGPLDLPKVIEYANSKGVGILVYVNKKAL
HQQLDEILPLYKIWGIKGVKYGFVNVGDQYATAWLHQAVRKAAKYELMVDIHDEYRPTGY
SRTYPNLLTQEGIRGDEEGPSLDQAIYTLYNRMICGAGDYTNCYFAERVTAKMGGRAAQL
AKLVAIYSPWQFVYWYDRPEKSPRKAGGAGSAESVIKTDVATRFYNSIPTVWDDTRFMDG
KMGDYAVVARRSGSDWYVSVLNAGEKKQVSVPLDFLKDVTTYNATLYYQAPGKKKDVVSI
KTMKLQPSLTLDVEANSGCVLHITR

Enzyme Prediction     

No EC number prediction in MGYG000003701_01504.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH97	19	623	4.2e-147	0.9825673534072901

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam14508	GH97_N	7.81e-55	28	264	1	235	Glycosyl-hydrolase 97 N-terminal. This N-terminal domain of glycosyl-hydrolase-97 contributes part of the active site pocket. It is also important for contact with the catalytic and C-terminal domains of the whole.
pfam10566	Glyco_hydro_97	1.83e-54	270	500	2	262	Glycoside hydrolase 97. This domain is the catalytic region of the bacterial glycosyl-hydrolase family 97. This central part of the GH97 family protein sequences represents a typical and complete (beta/alpha)8-barrel or catalytic TIM-barrel type domain. The N- and C-terminal parts of the sequences, mainly consisting of beta-strands, form two additional non-catalytic domains. In all known glycosidases with the (beta-alpha)8-barrel fold, the amino acid residues at the active site are located on the C-termini of the beta-strands.
pfam14509	GH97_C	5.92e-26	532	624	1	97	Glycosyl-hydrolase 97 C-terminal, oligomerization. Glycosyl-hydrolase-97 is made up of three tightly linked and highly conserved globular domains. The C-terminal domain is found to be necessary for oligomerization of the whole molecule in order to create the active-site pocket and the Ca++-binding site.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT49474.1	8.30e-246	240	624	6	392
QRY59940.1	7.58e-235	24	625	22	629
QQT29248.1	1.52e-234	24	625	22	629
QQT54718.1	1.15e-233	24	625	22	627
QOD61816.1	5.27e-219	1	625	1	636

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5E1Q_A	1.19e-59	27	587	19	614	Mutant(D415G) GH97 alpha-galactosidase in complex with Gal-Lac [Bacteroides thetaiotaomicron VPI-5482],5E1Q_B Mutant (D415G) GH97 alpha-galactosidase in complex with Gal-Lac [Bacteroides thetaiotaomicron VPI-5482]
3A24_A	9.01e-59	27	587	5	600	Crystalstructure of BT1871 retaining glycosidase [Bacteroides thetaiotaomicron],3A24_B Crystal structure of BT1871 retaining glycosidase [Bacteroides thetaiotaomicron]
3WFA_A	4.68e-49	26	590	5	664	Catalyticrole of the calcium ion in GH97 inverting glycoside hydrolase [Bacteroides thetaiotaomicron],3WFA_B Catalytic role of the calcium ion in GH97 inverting glycoside hydrolase [Bacteroides thetaiotaomicron]
2JKA_A	4.72e-49	26	590	14	673	Nativestructure of a family 97 alpha-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],2JKA_B Native structure of a family 97 alpha-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],2JKE_A Structure of a family 97 alpha-glucosidase from Bacteroides thetaiotaomicron in complex with deoxynojirimycin [Bacteroides thetaiotaomicron VPI-5482],2JKE_B Structure of a family 97 alpha-glucosidase from Bacteroides thetaiotaomicron in complex with deoxynojirimycin [Bacteroides thetaiotaomicron VPI-5482],2JKP_A Structure of a family 97 alpha-glucosidase from Bacteroides thetaiotaomicron in complex with castanospermine [Bacteroides thetaiotaomicron VPI-5482],2JKP_B Structure of a family 97 alpha-glucosidase from Bacteroides thetaiotaomicron in complex with castanospermine [Bacteroides thetaiotaomicron VPI-5482]
2D73_A	5.26e-49	26	590	25	684	CrystalStructure Analysis of SusB [Bacteroides thetaiotaomicron VPI-5482],2D73_B Crystal Structure Analysis of SusB [Bacteroides thetaiotaomicron VPI-5482],2ZQ0_A Crystal structure of SusB complexed with acarbose [Bacteroides thetaiotaomicron],2ZQ0_B Crystal structure of SusB complexed with acarbose [Bacteroides thetaiotaomicron]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8A6L0	1.51e-60	1	587	1	621	Retaining alpha-galactosidase OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=BT_1871 PE=1 SV=1
G8JZS4	2.88e-48	26	590	25	684	Glucan 1,4-alpha-glucosidase SusB OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=susB PE=1 SV=1
D7CFN7	1.09e-47	35	573	48	574	Probable retaining alpha-galactosidase OS=Streptomyces bingchenggensis (strain BCW-1) OX=749414 GN=SBI_01652 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000614	0.998437	0.000353	0.000185	0.000199	0.000192

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003701_01504.