CAZyme Information: MGYG000003701_00111

Basic Information

• Species: Parabacteroides sp003480915
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Tannerellaceae; Parabacteroides; Parabacteroides sp003480915
• CAZyme ID: MGYG000003701_00111
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
393	MGYG000003701_1|CGC3	45457.96	8.4783

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003701	6084075	Isolate	China	Asia

• Gene Location: Start: 127779; End: 128960 Strand: -

Full Sequence      

MDQFIYFGTNWANNSEQIYLLGDAILFLIFLLGVLYITIFAVSSLKKRKATYPTAKKKYR
FAILISAYKADDTIINTVCSFLMQNYPRDKYDIIVTSDQMSEETNSNLIEKSAYVIKVNE
SNSSKTKALQTAVNYIKQNELMYDIVVVLDANNLVDIDFLEKINDAFYSGCSVVQTHRIA
QNKDTSIELLDAVSEEINNSIFRKGHTQLGFSAALTGSGMAIEYDLFEDLISQAKYSDLD
KQFEKSLLKQNIYIEYLEYVYVYDEKVKGKIGFYNQRRRWLASQFSNLFSGISHLLPAIL
KGNWDYCDKLFQWMMPPRIILFGFIFLFACIFTYANWILSIKWWGLLLLLCIAFSIAVPD
YLVDKKFRKALLILPILFILMLFNFSRLKGSKK

Enzyme Prediction     

No EC number prediction in MGYG000003701_00111.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	60	281	2.8e-24	0.9782608695652174

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam13641	Glyco_tranf_2_3	9.11e-23	60	281	3	228	Glycosyltransferase like family 2. Members of this family of prokaryotic proteins include putative glucosyltransferase, which are involved in bacterial capsule biosynthesis.
cd06438	EpsO_like	1.58e-22	63	229	1	169	EpsO protein participates in the methanolan synthesis. The Methylobacillus sp EpsO protein is predicted to participate in the methanolan synthesis. Methanolan is an exopolysaccharide (EPS), composed of glucose, mannose and galactose. A 21 genes cluster was predicted to participate in the methanolan synthesis. Gene disruption analysis revealed that EpsO is one of the glycosyltransferase enzymes involved in the synthesis of repeating sugar units onto the lipid carrier.
COG1215	BcsA	1.21e-18	24	358	19	356	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
cd06423	CESA_like	2.93e-18	63	230	1	169	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
pfam13632	Glyco_trans_2_3	9.25e-16	145	356	1	194	Glycosyl transferase family group 2. Members of this family of prokaryotic proteins include putative glucosyltransferases, which are involved in bacterial capsule biosynthesis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKH97648.1	1.42e-176	1	393	1	393
QUT19159.1	1.42e-176	1	393	1	393
QUT54379.1	1.42e-176	1	393	1	393
QJE27398.1	2.59e-162	1	393	2	394
QUR50525.1	1.71e-161	1	392	2	393

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000045	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
20	42
280	299
319	341
343	361
371	388