CAZyme Information: MGYG000003701_00107

Basic Information

• Species: Parabacteroides sp003480915
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Tannerellaceae; Parabacteroides; Parabacteroides sp003480915
• CAZyme ID: MGYG000003701_00107
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
386	MGYG000003701_1|CGC3	45268.9	9.4672

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003701	6084075	Isolate	China	Asia

• Gene Location: Start: 123313; End: 124473 Strand: -

Full Sequence      

MALFTLIDHIIFAIMSIFIGYNCIFITAAFLRKKKRENKPQDIQKFAVIFPAYKEDNVIC
HSVEIFLKQDYPKEKYDVIVVSDNMKEGTNDKLASFPIKLFLPKFKESMKYKSIQYALNN
LNGYDRVIIMDADNLVEINFLSQVNIQTQNGVVLQAHRTYKNVNTKVAVWDGISEAINNT
IYRRGHVALGLSAALIGSGMVFDFNWLKENIRHCSTFAEDKELEILLAQNNIPVDYADDI
YVYDEKTTREDVLIRQRSRWLHAQFMAFSLIIKHFSFKNISWNYIDKIFQWLPLPKAIRF
TIITLFTVINSLFFFPLAIKWYILIGIKFWSYFIAIPQEMLNKNLFANLPNIFWIMLQSF
VSSLKRLKNKITQFDNTPHEIIKKDE

Enzyme Prediction     

No EC number prediction in MGYG000003701_00107.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	45	261	7.4e-21	0.9782608695652174

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam13641	Glyco_tranf_2_3	2.72e-20	44	261	2	228	Glycosyltransferase like family 2. Members of this family of prokaryotic proteins include putative glucosyltransferase, which are involved in bacterial capsule biosynthesis.
cd06423	CESA_like	3.63e-20	48	220	1	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
cd06438	EpsO_like	1.20e-18	48	223	1	183	EpsO protein participates in the methanolan synthesis. The Methylobacillus sp EpsO protein is predicted to participate in the methanolan synthesis. Methanolan is an exopolysaccharide (EPS), composed of glucose, mannose and galactose. A 21 genes cluster was predicted to participate in the methanolan synthesis. Gene disruption analysis revealed that EpsO is one of the glycosyltransferase enzymes involved in the synthesis of repeating sugar units onto the lipid carrier.
COG1215	BcsA	2.92e-16	2	340	12	362	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
pfam13632	Glyco_trans_2_3	1.35e-13	127	325	2	194	Glycosyl transferase family group 2. Members of this family of prokaryotic proteins include putative glucosyltransferases, which are involved in bacterial capsule biosynthesis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIX67080.1	3.85e-144	1	386	1	391
QUR50512.1	5.46e-144	1	386	1	391
QCY56530.1	2.21e-143	1	381	1	385
AST53771.1	1.79e-142	1	381	1	385
QRO16754.1	1.79e-142	1	381	1	385

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P96587	2.71e-07	34	279	40	296	Uncharacterized glycosyltransferase YdaM OS=Bacillus subtilis (strain 168) OX=224308 GN=ydaM PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000050	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
10	32
185	207
260	282
303	325
345	364