CAZyme Information: MGYG000003698_01333

Basic Information

• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; Coriobacteriaceae; Collinsella
• CAZyme ID: MGYG000003698_01333
• CAZy Family: GH1
• CAZyme Description: Aryl-phospho-beta-D-glucosidase BglH

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
486	MGYG000003698_2|CGC7	55089.89	4.8795

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003698	2292509	Isolate	China	Asia

• Gene Location: Start: 262064; End: 263524 Strand: +

Full Sequence      

MGRFPDGFLWGGAISANQIEGAWDVDGKGVSVPDVCTAGSHKVDKRITPTLEPDTFYPSH
EACDFYHRYREDIAMLAEMGFKALRLSIAWTRVFPTGEEAEPNELGLAFYDRVFDCCREH
GIEPIVTLSHYEMPYALASKYNGWAGHELIACFERFCACVFERYRGKVRYWLTLNEMNTG
IGRGGAVLNLSTVRGYEGPVNGLPDNPAERFQALHHMLVAAARVTALAHERYPEYRIGCM
SSFALMYPYTCDPDDAVLVQQRMRVANWFCSDVQVRGYYPSYMRRHFAERGIEVAMEPDD
AETLARGTVDFVTFSYYMSVCLSAHPEKLETTGGNFAFGAKNPYLKTSDWGWQVDPVGLR
WSLNAIWDRYQKPVMLVENGLGAYDTVEEDGSIHDPYRIEYLRQHIEQMAEAVADGVDLM
GYTSWGPIDLVSASTGEFAKRYGFIYVDRHDDGTGTFERSRKDSFYWYQRVIETNGEDLG
GEVSHA

Enzyme Prediction     

EC	3.2.1.86	3.2.1.21	3.2.1.37

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	3	476	3.6e-147	0.9883449883449883

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK09589	celA	0.0	1	479	1	476	6-phospho-beta-glucosidase; Reviewed
PRK09852	PRK09852	0.0	1	480	1	474	cryptic 6-phospho-beta-glucosidase; Provisional
PRK15014	PRK15014	0.0	4	479	6	477	6-phospho-beta-glucosidase BglA; Provisional
COG2723	BglB	0.0	1	478	1	456	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
PRK09593	arb	0.0	4	479	6	477	6-phospho-beta-glucosidase; Reviewed

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VDS02424.1	6.10e-245	1	480	1	479
CBL00156.1	8.66e-245	1	480	1	479
ATL90836.1	2.48e-244	1	480	1	479
ATP00623.1	3.51e-244	1	480	1	479
QIA43655.1	3.51e-244	1	480	1	479

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6WGD_A	2.58e-185	3	479	7	469	Crystalstructure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_B Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_C Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis]
2XHY_A	1.71e-178	5	479	9	479	CrystalStructure of E.coli BglA [Escherichia coli K-12],2XHY_B Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_C Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_D Crystal Structure of E.coli BglA [Escherichia coli K-12]
4F66_A	3.09e-169	1	479	4	480	Thecrystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans],4F66_B The crystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans]
4F79_A	8.80e-169	1	479	4	480	Thecrystal structure of 6-phospho-beta-glucosidase mutant (E375Q) in complex with Salicin 6-phosphate [Streptococcus mutans],4GPN_A The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159],4GPN_B The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159]
4IPL_A	2.39e-165	1	479	17	485	Thecrystal structure of 6-phospho-beta-glucosidase BglA-2 from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4],4IPL_B The crystal structure of 6-phospho-beta-glucosidase BglA-2 from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4],4IPN_B The complex structure of 6-phospho-beta-glucosidase BglA-2 with thiocellobiose-6P from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4],4IPN_E The complex structure of 6-phospho-beta-glucosidase BglA-2 with thiocellobiose-6P from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P40740	7.09e-180	3	479	7	469	Aryl-phospho-beta-D-glucosidase BglH OS=Bacillus subtilis (strain 168) OX=224308 GN=bglH PE=1 SV=2
P42973	2.86e-179	1	479	1	479	Aryl-phospho-beta-D-glucosidase BglA OS=Bacillus subtilis (strain 168) OX=224308 GN=bglA PE=1 SV=1
Q46829	9.38e-178	5	479	9	479	6-phospho-beta-glucosidase BglA OS=Escherichia coli (strain K12) OX=83333 GN=bglA PE=1 SV=2
P26206	1.34e-171	4	479	5	463	6-phospho-beta-glucosidase OS=Dickeya chrysanthemi OX=556 GN=arbB PE=3 SV=1
Q48409	2.60e-171	1	479	1	462	Phospho-cellobiase OS=Klebsiella oxytoca OX=571 GN=casB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999631	0.000391	0.000004	0.000001	0.000000	0.000001

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003698_01333.