CAZyme Information: MGYG000003690_01455

Basic Information

• Species: Lactobacillus gasseri
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Lactobacillaceae; Lactobacillus; Lactobacillus gasseri
• CAZyme ID: MGYG000003690_01455
• CAZy Family: GH73
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
208	MGYG000003690_8|CGC1	24103.3	9.3499

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003690	1974540	Isolate	China	Asia

• Gene Location: Start: 56483; End: 57109 Strand: -

Full Sequence      

MPRRRRQKNIQYVIARAFAICFTLVVILSGFLYWRHEVAVNEQLRQARLEKERALQSKER
FIKIVAPIAQRADKPYGLFPSVTIAQACLESNFGQSELSKKYYNLFGVKGTDPNTSRELT
TSEFVNDHWETVTGRFQVYNSYEESIQAHTRLFVNGTSWNKNQYQHVLAAKDYISQAQAL
ETDGYATDPGYAKKLIDLIKEFNLTQYD

Enzyme Prediction     

No EC number prediction in MGYG000003690_01455.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	66	204	2.2e-36	0.984375

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1705	FlgJ	5.25e-60	57	208	42	188	Flagellum-specific peptidoglycan hydrolase FlgJ [Cell wall/membrane/envelope biogenesis, Cell motility].
PRK08581	PRK08581	3.20e-36	56	208	318	472	amidase domain-containing protein.
smart00047	LYZ2	7.85e-36	51	208	1	147	Lysozyme subfamily 2. Eubacterial enzymes distantly related to eukaryotic lysozymes.
PRK06347	PRK06347	1.57e-29	51	208	140	303	1,4-beta-N-acetylmuramoylhydrolase.
NF038016	sporang_Gsm	2.02e-26	61	208	163	312	sporangiospore maturation cell wall hydrolase GsmA. The peptidoglycan-hydrolyzing enzyme GsmA occurs in some sporangia-forming members of the Actinobacteria, such as Actinoplanes missouriensis, and is required for proper separation of spores. GsmA proteins have one or two SH3 domains N-terminal to the hydrolase domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QTH66810.1	3.74e-150	1	208	1	208
ABJ60872.1	3.74e-150	1	208	1	208
ASY53132.1	1.52e-149	1	208	1	208
ART98595.1	7.24e-148	1	208	1	208
QHC53737.1	7.24e-148	1	208	1	208

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3FI7_A	4.56e-27	61	208	33	183	CrystalStructure of the autolysin Auto (Lmo1076) from Listeria monocytogenes, catalytic domain [Listeria monocytogenes EGD-e]
5T1Q_A	2.39e-21	61	208	63	212	ChainA, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_B Chain B, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_C Chain C, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_D Chain D, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325]
5DN5_A	1.44e-17	55	201	1	147	Structureof a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_B Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_C Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
5DN4_A	2.00e-17	55	201	1	147	Structureof the glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
3VWO_A	3.02e-16	61	206	4	150	Crystalstructure of peptidoglycan hydrolase mutant from Sphingomonas sp. A1 [Sphingomonas sp. A1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O32083	3.09e-35	61	208	51	198	Exo-glucosaminidase LytG OS=Bacillus subtilis (strain 168) OX=224308 GN=lytG PE=1 SV=1
P0C2T5	5.01e-27	22	208	30	214	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. cremoris OX=1359 GN=acmA PE=3 SV=1
Q9CIT4	3.55e-26	22	208	30	214	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. lactis (strain IL1403) OX=272623 GN=acmA PE=3 SV=1
A2RHZ5	4.82e-26	22	208	30	214	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. cremoris (strain MG1363) OX=416870 GN=acmA PE=3 SV=1
Q2G222	3.44e-20	61	208	323	472	N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 OS=Staphylococcus aureus (strain NCTC 8325 / PS 47) OX=93061 GN=SAOUHSC_02979 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.991019	0.000171	0.000101	0.000001	0.000001	0.008734

TMHMM  Annotations     

start	end
12	34