CAZyme Information: MGYG000003690_00011

Basic Information

• Species: Lactobacillus gasseri
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Lactobacillaceae; Lactobacillus; Lactobacillus gasseri
• CAZyme ID: MGYG000003690_00011
• CAZy Family: GT8
• CAZyme Description: General stress protein A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
316	MGYG000003690_1|CGC1	37170.02	5.5588

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003690	1974540	Isolate	China	Asia

• Gene Location: Start: 11468; End: 12418 Strand: -

Full Sequence      

MTIPVFYSISDDFAKYAAVSLNSLVKNANPQKDYTATFLNQDLSEKHQKQLAAFANDHVH
VKFFHIDEKLVKPIQNRKENYLRADFFTMSIFYRLFIPDLFPQYDKAIYIDSDTVVVDDI
AKLYNNDLGNNLFAACTDSSIQYVDKMVKYIKEVLALDPKKYINSGMLVLNSKAFRDEHF
IDHFMHLLEQYHFDCIAPDQDYLNEIGDGRILHLDPRWDAMPNENTAPIPEPGLIHYNLF
FKPWHFKDVQYNDYFWKYASSTPFYEELKSELDNYTNQERAEDRAKLDHMLEKEASTALD
PNNWAQIKRKGERVKL

Enzyme Prediction     

No EC number prediction in MGYG000003690_00011.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT8	4	247	4e-52	0.8754863813229572

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04194	GT8_A4GalT_like	1.33e-68	3	246	1	248	A4GalT_like proteins catalyze the addition of galactose or glucose residues to the lipooligosaccharide (LOS) or lipopolysaccharide (LPS) of the bacterial cell surface. The members of this family of glycosyltransferases catalyze the addition of galactose or glucose residues to the lipooligosaccharide (LOS) or lipopolysaccharide (LPS) of the bacterial cell surface. The enzymes exhibit broad substrate specificities. The known functions found in this family include: Alpha-1,4-galactosyltransferase, LOS-alpha-1,3-D-galactosyltransferase, UDP-glucose:(galactosyl) LPS alpha1,2-glucosyltransferase, UDP-galactose: (glucosyl) LPS alpha1,2-galactosyltransferase, and UDP-glucose:(glucosyl) LPS alpha1,2-glucosyltransferase. Alpha-1,4-galactosyltransferase from N. meningitidis adds an alpha-galactose from UDP-Gal (the donor) to a terminal lactose (the acceptor) of the LOS structure of outer membrane. LOSs are virulence factors that enable the organism to evade the immune system of host cells. In E. coli, the three alpha-1,2-glycosyltransferases, that are involved in the synthesis of the outer core region of the LPS, are all members of this family. The three enzymes share 40 % of sequence identity, but have different sugar donor or acceptor specificities, representing the structural diversity of LPS.
COG1442	RfaJ	4.25e-44	1	265	1	267	Lipopolysaccharide biosynthesis protein, LPS:glycosyltransferase [Cell wall/membrane/envelope biogenesis].
pfam01501	Glyco_transf_8	1.02e-40	4	245	1	249	Glycosyl transferase family 8. This family includes enzymes that transfer sugar residues to donor molecules. Members of this family are involved in lipopolysaccharide biosynthesis and glycogen synthesis. This family includes Lipopolysaccharide galactosyltransferase, lipopolysaccharide glucosyltransferase 1, and glycogenin glucosyltransferase.
cd00505	Glyco_transf_8	2.34e-16	5	245	4	245	Members of glycosyltransferase family 8 (GT-8) are involved in lipopolysaccharide biosynthesis and glycogen synthesis. Members of this family are involved in lipopolysaccharide biosynthesis and glycogen synthesis. GT-8 comprises enzymes with a number of known activities: lipopolysaccharide galactosyltransferase, lipopolysaccharide glucosyltransferase 1, glycogenin glucosyltransferase, and N-acetylglucosaminyltransferase. GT-8 enzymes contains a conserved DXD motif which is essential in the coordination of a catalytic divalent cation, most commonly Mn2+.
cd06429	GT8_like_1	2.54e-14	3	258	1	255	GT8_like_1 represents a subfamily of GT8 with unknown function. A subfamily of glycosyltransferase family 8 with unknown function: Glycosyltransferase family 8 comprises enzymes with a number of known activities; lipopolysaccharide galactosyltransferase lipopolysaccharide glucosyltransferase 1, glycogenin glucosyltransferase and inositol 1-alpha-galactosyltransferase. It is classified as a retaining glycosyltransferase, based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ABJ59472.1	3.06e-237	1	316	1	316
QTH65488.1	3.06e-237	1	316	1	316
ASY54495.1	1.02e-235	1	316	1	316
VEF34406.1	5.02e-227	1	316	1	316
QGT96933.1	7.13e-227	1	316	1	316

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6U4B_A	1.23e-25	3	268	302	592	ChainA, WbbM protein [Klebsiella pneumoniae]
1SS9_A	2.07e-15	3	245	1	253	ChainA, alpha-1,4-galactosyl transferase [Neisseria meningitidis]
1G9R_A	8.18e-14	7	245	5	253	ChainA, GLYCOSYL TRANSFERASE [Neisseria meningitidis],1GA8_A Chain A, GALACTOSYL TRANSFERASE LGTC [Neisseria meningitidis]
3TZT_A	4.24e-09	84	215	80	209	Thestructure of a protein in glycosyl transferase family 8 from Anaerococcus prevotii. [Anaerococcus prevotii DSM 20548],3TZT_B The structure of a protein in glycosyl transferase family 8 from Anaerococcus prevotii. [Anaerococcus prevotii DSM 20548]
5GVV_A	1.69e-08	92	259	88	251	Crystalstructure of the glycosyltransferase GlyE in Streptococcus pneumoniae TIGR4 [Streptococcus pneumoniae],5GVV_F Crystal structure of the glycosyltransferase GlyE in Streptococcus pneumoniae TIGR4 [Streptococcus pneumoniae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P43974	1.80e-16	2	247	38	281	Putative glycosyltransferase HI_0258 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=HI_0258 PE=3 SV=2
P25148	2.49e-15	11	262	15	274	General stress protein A OS=Bacillus subtilis (strain 168) OX=224308 GN=gspA PE=1 SV=2
A0A0H2URA3	2.83e-09	2	258	3	250	Glycosyltransferase GlyB OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=glyB PE=3 SV=1
A0A0H2URH7	6.97e-08	88	258	377	541	Glycosyltransferase GlyA OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=glyA PE=3 SV=1
Q9AEU2	9.22e-08	63	258	58	253	Probable glycosyl transferase Gly OS=Streptococcus gordonii OX=1302 GN=gly PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000041	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003690_00011.