CAZyme Information: MGYG000003684_04751

Basic Information

• Species: Eisenbergiella massiliensis
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Eisenbergiella; Eisenbergiella massiliensis
• CAZyme ID: MGYG000003684_04751
• CAZy Family: GH2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
849	MGYG000003684_25|CGC1	97871.12	4.7655

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003684	6691925	Isolate	China	Asia

• Gene Location: Start: 51299; End: 53848 Strand: +

Full Sequence      

MIEQTLHTGWTMRRAGEQEWLPASVPGSVYGDLLSNGRMEDPFWKDNEDKALSLMEYDYE
YVTQFDCPEEIRESDRVLLHFDGLDTIADVYLNGEHLGNAYSMHRIWEYDVKEKVRPAGN
ELRVVLHSPTKFIRQAFQECRTLGNDDTLEGFVHIRKAHYMFGWDWGAHLPDAGIFRPVT
LLGIDRGRIDNVLILQEHERVPEADSDAAIAALGNRSVSGVVLKLQVTEETAGITDGVPK
LMDVTGGRLFCGCGQHMSYTVEITAPDGTKSVTENSPSEIRIEHPRLWWPNGYGAQDLYT
VKVILYSDGREIDSWEKRIGLRTMAMRRRKDEWGECFAHEVNGVAVFAMGGDYIPEDNLL
GRVTPETTAKLLKKARFANYNAIRVWGGGYYPSDWFYDLCDEMGLMVWQDFMFACAVYEL
TPAFEANIRQEFIENVKRIRHHASLGLWCGNNEMEQFVFEKNSWLTKASEVRDYFLMFER
IIPEIVHTYDPQAFYWPASPSSGGCLDEPNDPNRGDVHYWAVWHGNRPFSEYRKYFFRYA
SEFGFQAFPSLKTIETFTDDPEDYNAFSYICEKHQRQYGANGKIMGYMQQTYKYPSDFDT
FIYASQLLQADAIRYGVEHFRRNRGRCMGAIYWQLNDCWPVVSWSSVDYAGRLKALHYYA
RRFFAPVLLSCEEQGMMSAEANMNREHFEFEKSIRLNVANETMQEAQVTVRWALRNPKAE
ILEGGEETLSVPALTSVWLDKVLYPQAELRTNYVSYEMEMDGQIVSDGTVNFSYPKYFCY
ENPQLSCEIAGDEITVTAQAYAKSVEIRNEEDNLVLSDNFFDMNAGTKTVKILEGNTEGI
RLRSVYDIR

Enzyme Prediction     

No EC number prediction in MGYG000003684_04751.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	4	734	1.1e-102	0.6928191489361702

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	1.16e-101	22	670	27	635	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
PRK10340	ebgA	4.68e-11	76	453	127	449	cryptic beta-D-galactosidase subunit alpha; Reviewed
pfam00703	Glyco_hydro_2	7.17e-10	260	322	47	106	Glycosyl hydrolases family 2. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
pfam17786	Mannosidase_ig	7.77e-10	694	777	3	91	Mannosidase Ig/CBM-like domain. This domain corresponds to domain 4 in the structure of Bacteroides thetaiotaomicron beta-mannosidase, BtMan2A. This domain has an Ig-like fold.
pfam17753	Ig_mannosidase	3.58e-09	782	847	1	78	Ig-fold domain. This Ig-like fold domain is found in mannosidase enzymes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBE97789.1	0.0	1	849	15	837
QIB54534.1	0.0	1	849	1	823
QMW79049.1	0.0	1	849	1	823
QJU13790.1	0.0	1	849	1	823
QQQ93614.1	0.0	1	849	1	823

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6BYE_A	8.85e-151	1	849	3	848	Crystalstructure of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri in complex with mannose [Xanthomonas citri pv. citri str. 306],6BYE_B Crystal structure of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri in complex with mannose [Xanthomonas citri pv. citri str. 306]
6BYC_A	9.10e-151	1	849	3	848	Crystalstructure of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306]
6BYI_A	6.47e-150	1	849	1	846	Crystalstructure of the acid-base mutant (E477A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306],6BYI_B Crystal structure of the acid-base mutant (E477A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306]
6BYG_A	6.65e-150	1	849	3	848	Crystalstructure of the nucleophile mutant (E575A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306],6BYG_B Crystal structure of the nucleophile mutant (E575A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306]
2VJX_A	2.26e-146	6	833	11	816	Structuraland biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VJX_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VQT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VQT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VR4_A Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482],2VR4_B Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q0CCA0	1.09e-113	2	835	5	828	Beta-mannosidase B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=mndB PE=3 SV=2
A1CGA8	9.73e-109	6	839	9	834	Beta-mannosidase B OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=mndB PE=3 SV=1
Q4WAH4	9.73e-109	6	780	9	768	Beta-mannosidase B OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=mndB PE=3 SV=1
A1D911	3.69e-108	6	780	9	768	Beta-mannosidase B OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=mndB PE=3 SV=1
B0YBU9	3.69e-108	6	780	9	768	Beta-mannosidase B OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=mndB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000062	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003684_04751.