CAZyme Information: MGYG000003684_03197

Basic Information

• Species: Eisenbergiella massiliensis
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Eisenbergiella; Eisenbergiella massiliensis
• CAZyme ID: MGYG000003684_03197
• CAZy Family: GH127
• CAZyme Description: Non-reducing end beta-L-arabinofuranosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
670	MGYG000003684_11|CGC1	76509.84	4.9627

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003684	6691925	Isolate	China	Asia

• Gene Location: Start: 17102; End: 19114 Strand: -

Full Sequence      

MLTDTRKSPNARLQGIPFSDVEWTHGLYKERFDTCAGSTVPHLQNMFERREVSHVLENFR
IAAGDADGDFDGTVFGDGDFYKWMEAAVYTAVRTDNRELLAQLEDYIALIGRAQQPDGYI
STKQIIGERSGKASRLGDINDFEVYNFGHLFTSACLYKRLTGRDSFLEIAEKAAEYLNRL
YAEAEEKGEVQTAVCPSHYMGLAELYRTTGNPEYLALLKKAVMLRDSVKEGMDDNQDRLM
LKAHDKIIGHAVRANYLYAGVADLCLEEEDPELMEVLHKVWRSLVTQKLYITGGCGALYN
GASPYGNFFGHQLVHQAYGYEYQLPNVTAYNETCASIGGVYWAWRMFCLEKKTEYADVLE
RMLLNVNLAAVSMDGKRFFYENMLRRAKKLPYELIWGQERAEYILSYCCPPNLARLMAQM
SEYAYALDESGVYTVLYGASRARISLPGRGEEAFILIQETEYPYDGAVRFTFEKEREQQR
ELNGFALHLRIPAWVRSAKLRLGNRTNGREISLQTLRREDAGTYLTVWVDKPQETEVLLE
LGMEARLTCAHSLVEETVNQVAVERGPLVYCMEGMDAPVETIDDLFIPSDISLQPELFEI
GGRTVTALTGTFLKKRTDGKDGYDRQALYQDYVDRGYEKIKGRMIPYFAWDNRGMDEMRI
WMPVTDVRSL

Enzyme Prediction     

EC	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH127	21	571	3e-153	0.9980916030534351

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07944	Glyco_hydro_127	1.12e-130	20	571	1	503	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
COG3533	COG3533	3.28e-108	5	662	3	585	Uncharacterized conserved protein, DUF1680 family [Function unknown].
cd04791	LanC_SerThrkinase	7.85e-04	159	303	100	249	Lanthionine synthetase C-like domain associated with serine/threonine kinases. Some members of this subgroup lack the zinc binding site and the active site residues, and therefore are most likely inactive. The function of this domain is unknown.
cd00249	AGE	0.008	144	221	59	143	AGE domain; N-acyl-D-glucosamine 2-epimerase domain; Responsible for intermediate epimerization during biosynthesis of N-acetylneuraminic acid. Catalytic mechanism is believed to be via nucleotide elimination and readdition and is ATP modulated. AGE is structurally and mechanistically distinct from the other four types of epimerases. The AGE domain monomer is composed of an alpha(6)/alpha(6)-barrel, the structure of which is also found in glucoamylase and cellulase. The active form is a homodimer. The alignment also contains subtype III mannose 6-phosphate isomerases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AGC67292.1	4.34e-278	1	664	1	649
AGI38357.1	4.34e-278	1	664	1	649
ANX00320.1	6.15e-278	1	664	1	649
ANW97794.1	2.87e-276	1	664	1	649
QOV18624.1	2.71e-261	1	664	1	649

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MQO_A	3.24e-168	2	664	25	696	Glycosidehydrolase BT_1003 [Bacteroides thetaiotaomicron]
4QJY_A	7.71e-107	28	662	23	645	Crystalstructure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QJY_B Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
4QK0_A	3.98e-102	28	662	23	645	Crystalstructure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_B Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_C Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_D Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
6EX6_A	2.57e-85	16	664	10	625	TheGH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482],6EX6_B The GH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482]
7EXU_A	2.49e-79	53	661	51	655	ChainA, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
E8MGH8	2.91e-78	53	661	51	655	Non-reducing end beta-L-arabinofuranosidase OS=Bifidobacterium longum subsp. longum (strain ATCC 15707 / DSM 20219 / JCM 1217 / NCTC 11818 / E194b) OX=565042 GN=hypBA1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000080	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003684_03197.