CAZyme Information: MGYG000003684_02828

Basic Information

• Species: Eisenbergiella massiliensis
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Eisenbergiella; Eisenbergiella massiliensis
• CAZyme ID: MGYG000003684_02828
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
891	MGYG000003684_9|CGC2	103112.06	5.2537

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003684	6691925	Isolate	China	Asia

• Gene Location: Start: 81014; End: 83689 Strand: +

Full Sequence      

MSNDGVKKSKLNIQGMLCNGMRTPLGVSVKGCILRWIIAGEGKNIKQIQRWVQISEQENF
EHLTYEGKSYSGETQWELKNVFQEKTKYYWRVRVQISHGEKAEWLDWSDYSFFETAMAGQ
ESWEAQWIEANEEFYKDALEVSRGFWKKNIKKPEMDQGLRRPVYFHREWNLSEGWECGRV
YITALGFYQLTVNDTKIGDYALAPDFTAYDKLVYYQTYDITPYLKNGKNSFDIILADGWY
AGHAQGIPGMNYLYGERPALIMQAEIGYADGKMQKLCSDDTFEAYSGPFLYADLFMGEYL
DMRQSLVPYGTVKKAYPKHILTPQEYEGIKVKTVLEARTVTKFSEGSFIADFGQVLAGRE
KITLENEAGQLIKIEHSEILNPDSGDLLEITQRFPFHDQTDYIYVTTDHYVYEPQFSFQG
YRYIKISGLKGELNPGQCKSVVLETGLKDTSCFECSDGNINRLIQNAYWSQCGNMISIPT
DCPQRERGGFTGDAQIFCSTAIWQQEVQGFFRRWLKQCRLEQLKRGQIPIVVPYTDAYRR
SEPNPGWTSAGWGDAIIFAARDLYEGYGNINILEENYEAMEKWMAYVTACAEDSMPEQYY
MDYKKRPFMKYLWNTGYHWGDWLMPGFSDEDGVAASKEITAALFYFREAKCMYQISEILG
KEDRAAYYKDLTEKIRLAFHSVYITKDKRLLNELQGLYVMAIAFGMVQDDTKRIFERRLE
ALVKAADYHLATGFLSTPFLLDVLWDAGFHDTACKVLYQDTCPSWLYEVKMGATTIWENW
EGIREDGSISTHSFNHYAFGCIADFIYRRIAGVKRLAPGFRKIMIYPEVTDRISCVSFSY
DTLFGEIKVRWEKAEEGYQYWLSIPHGMEAVVKGNKEIKEIGSGEWVFTLK

Enzyme Prediction     

No EC number prediction in MGYG000003684_02828.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	340	872	9.2e-138	0.9940476190476191
CBM67	151	305	6.1e-21	0.8125

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	1.56e-101	448	810	1	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam08531	Bac_rhamnosid_N	4.51e-41	179	332	7	171	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
pfam05592	Bac_rhamnosid	1.69e-14	341	443	1	101	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	2.44e-09	812	885	1	74	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBI36516.1	7.36e-194	9	872	12	893
AYA78378.1	4.80e-193	13	872	7	881
QKS44705.1	1.08e-182	21	872	18	895
ABF44215.1	1.24e-180	16	872	8	884
AOY15666.1	7.61e-176	11	889	2	853

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3W5M_A	6.29e-123	179	891	320	1031	CrystalStructure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]
6I60_A	3.87e-110	18	872	37	896	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]
6GSZ_A	1.24e-102	152	884	121	859	Crystalstructure of native alfa-L-rhamnosidase from Aspergillus terreus [Aspergillus terreus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q82PP4	1.39e-121	179	890	320	1030	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1
T2KNB2	1.05e-109	85	873	114	877	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22090 PE=1 SV=2
P9WF03	9.78e-103	85	870	111	874	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1
T2KPL4	6.05e-78	8	870	27	902	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000095	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003684_02828.