CAZyme Information: MGYG000003684_01027

Basic Information

• Species: Eisenbergiella massiliensis
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Eisenbergiella; Eisenbergiella massiliensis
• CAZyme ID: MGYG000003684_01027
• CAZy Family: PL12
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
673	MGYG000003684_2|CGC12	76526.13	4.9791

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003684	6691925	Isolate	China	Asia

• Gene Location: Start: 577950; End: 579971 Strand: -

Full Sequence      

MTLDQYFDRPDSCYFVPDPGKLAAYCRENWEEDVNHILRIADEVCENTFLFDLSWDMERT
YEPVTFPEDIDWSFTPSGDPEFVWQFNRHRYFICLGQAWRLTGDEKYVKGFLRLINDWMD
RVPLNEKTGTGPWRMLETGLRGETWTKAIRYFKDSSLITEDFLERFAACLRLHAQRLVEK
GGDARLQSNWCVLENSGLFEIAMGLPQTEETGRWAALALKRIRESVKVQVYEDGSQWEQS
PMYHNEVYHCLCCVIYLAKANGIRLDPAMEDAVHRMALANVIWKKPDGCQFTQGDSDDTD
LRDKITMGAWLFKDPVLKYSGFPRLDYESAWDFGYGAVAGYDALACLPPDFTSAALKDSG
NYYLRESWEKDANLLHFTCGAMSTGHCHGDKLHVDLVINGEDVLVDGGRSTYMNVPIRFT
LKDNPGHNTTTVDGKSFTTFADSWETEKLSLPVNRSFRFGKTADFVQGGHLGYISEGIFV
NRRVIWIKPDIYLINDQFYAAGEHEYRQFFHFAPEGRLQTDGSMAAFRGKKNAAYFRFLT
EGTVLEQGTGITSRHYNQWEENSCLTARLKKEGFASMITVINGGDALTELARAELLEVRS
HTRQVKLADDEAQAVKVTAGDRSYVVILCHNEVFHGSDAVIADNCFGAGNVCVFDVTGVK
EGERVYGGEVLHV

Enzyme Prediction     

No EC number prediction in MGYG000003684_01027.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL12	359	496	1.1e-43	0.9925925925925926

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam16889	Hepar_II_III_N	8.56e-36	39	287	58	308	Heparinase II/III N-terminus. This is the N-terminal domain of heparinase II/III proteins. It is a toroid-like domain.
pfam07940	Hepar_II_III	7.92e-21	348	542	1	194	Heparinase II/III-like protein. This family features sequences that are similar to a region of the Flavobacterium heparinum proteins heparinase II and heparinase III. The former is known to degrade heparin and heparin sulphate, whereas the latter predominantly degrades heparin sulphate. Both are secreted into the periplasmic space upon induction with heparin.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SEU07992.1	0.0	1	673	1	674
AEN95953.1	1.75e-226	1	672	1	673
QIX90196.1	1.83e-220	1	655	9	690
QQR04156.1	5.57e-220	1	655	9	692
ANU50362.1	5.57e-220	1	655	9	692

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5JMD_A	2.48e-37	41	476	78	523	HeparinaseIII-BT4657 gene product, Methylated Lysines [Bacteroides thetaiotaomicron VPI-5482]
5JMF_A	2.80e-35	41	476	78	523	HeparinaseIII-BT4657 gene product [Bacteroides thetaiotaomicron VPI-5482]
4MMH_A	1.56e-25	59	560	87	559	Crystalstructure of heparan sulfate lyase HepC from Pedobacter heparinus [Pedobacter heparinus]
4MMI_A	1.56e-25	59	560	87	559	Crystalstructure of heparan sulfate lyase HepC mutant from Pedobacter heparinus [Pedobacter heparinus]
4FNV_A	6.99e-19	55	432	124	514	CrystalStructure of Heparinase III [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
C7EXL6	2.96e-34	39	436	87	485	Heparin-sulfate lyase OS=Bacteroides stercoris OX=46506 GN=hepC PE=1 SV=1
Q59289	9.02e-25	59	560	111	583	Heparin-sulfate lyase OS=Pedobacter heparinus (strain ATCC 13125 / DSM 2366 / CIP 104194 / JCM 7457 / NBRC 12017 / NCIMB 9290 / NRRL B-14731 / HIM 762-3) OX=485917 GN=hepC PE=1 SV=1
Q89YR9	3.83e-18	55	432	124	514	Heparin-sulfate lyase OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=hepC PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000039	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003684_01027.