CAZyme Information: MGYG000003684_00757

Basic Information

• Species: Eisenbergiella massiliensis
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Eisenbergiella; Eisenbergiella massiliensis
• CAZyme ID: MGYG000003684_00757
• CAZy Family: GH127
• CAZyme Description: Non-reducing end beta-L-arabinofuranosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
686	MGYG000003684_2|CGC7	78347.82	5.0129

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003684	6691925	Isolate	China	Asia

• Gene Location: Start: 277254; End: 279314 Strand: -

Full Sequence      

MEKNRQSSPVSLRKVQVTDAFWKHEMELVRREVIPYQWEALNDRIPEADPSFCMRNFKIA
GKITAQRKEMGADYKEVKWPIIFQPLPEDMEHMEDRFYGCLFQDSDFSKWIEAVGYSLTQ
HPDAELEKTADEAIDIVCAAQQENGYLDTYYIINDMSKVFTNLKDNHELYCFGHLTEGAV
AYYQATGKDKLLKAAQRYADYIASCFGPEPDKKKGYPGHEIAEMALVRLYEATGDDKYLN
LSRFFVDQRGTRPYYFDAEHPEAVKKGHEDELRYQYNQAHLPVREQDEAVGHAVRAVYLY
SGMADIARLTGDEALYAACEKLWDNITRKKMYITGGIGATHMGEAFSFNYDLPNDTAYAE
TCASIGLVFFARRMLEIKADRKYADVMERALYNGILSGMALDGKSFFYVNPLESLPEACH
KDERKFHVKPVRQKWFGCACCPPNIARLLSSIASYAYTEAEDSLYVHLYMGSVLEKDCGG
KKLDLRITSDFPWDGKVTAEVNAEAPTACRIAFRIPGWCRDYTINGKKGLREGESVTENG
ETRTVKDGYLIIDRVWEGGEKLELEFPMEVRLMQADGRVREDIGKAAVMRGPVVYCMEEA
DNGKNLHLCSLAADPAPEAKAEEKLGQRMVTVTTKGKRLVMQPEEAGELYQEYSRPEYEE
VQLQWIPYFAWANRGEGEMQVFIKAE

Enzyme Prediction     

No EC number prediction in MGYG000003684_00757.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH127	15	596	3.6e-225	0.9980916030534351

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3533	COG3533	0.0	12	686	9	588	Uncharacterized conserved protein, DUF1680 family [Function unknown].
pfam07944	Glyco_hydro_127	0.0	15	596	2	503	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
cd04791	LanC_SerThrkinase	6.55e-04	182	365	98	274	Lanthionine synthetase C-like domain associated with serine/threonine kinases. Some members of this subgroup lack the zinc binding site and the active site residues, and therefore are most likely inactive. The function of this domain is unknown.
COG1331	YyaL	0.003	179	322	419	563	Uncharacterized conserved protein YyaL, SSP411 family, contains thoiredoxin and six-hairpin glycosidase-like domains [General function prediction only].
COG4225	YesR	0.006	169	253	42	115	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIB58606.1	0.0	7	686	7	677
QMW76824.1	0.0	7	686	7	677
QBE95330.1	0.0	7	686	7	677
QJU15845.1	0.0	1	686	1	683
ANU78348.2	0.0	1	686	1	683

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4QJY_A	2.56e-229	15	683	16	645	Crystalstructure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QJY_B Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
4QK0_A	1.64e-222	15	683	16	645	Crystalstructure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_B Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_C Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_D Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
3WRE_A	3.13e-153	15	682	3	655	Thecrystal structure of native HypBA1 from Bifidobacterium longum JCM 1217 [Bifidobacterium longum subsp. longum JCM 1217],3WRG_A The complex structure of HypBA1 with L-arabinose [Bifidobacterium longum subsp. longum JCM 1217]
3WKW_A	4.38e-153	15	682	3	655	Crystalstructure of GH127 beta-L-arabinofuranosidase HypBA1 from Bifidobacterium longum ligand free form [Bifidobacterium longum subsp. longum JCM 1217],3WKX_A Crystal structure of GH127 beta-L-arabinofuranosidase HypBA1 from Bifidobacterium longum arabinose complex form [Bifidobacterium longum subsp. longum JCM 1217],7BZL_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217],7DIF_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217],7EXV_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217],7EXW_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217]
7EXU_A	1.23e-152	15	682	3	655	ChainA, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
E8MGH8	1.71e-152	15	682	3	655	Non-reducing end beta-L-arabinofuranosidase OS=Bifidobacterium longum subsp. longum (strain ATCC 15707 / DSM 20219 / JCM 1217 / NCTC 11818 / E194b) OX=565042 GN=hypBA1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000050	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003684_00757.