CAZyme Information: MGYG000003681_03130

Basic Information

• Species: Bacteroides stercoris
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides stercoris
• CAZyme ID: MGYG000003681_03130
• CAZy Family: GH20
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
328	MGYG000003681_44|CGC1	36964.06	5.4232

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003681	3833391	Isolate	China	Asia

• Gene Location: Start: 15430; End: 16416 Strand: -

Full Sequence      

MWGGLKWLPGKTPVQAEGVTVNAWSYDWIDPEASLKDGYKLINSCDTYLYIVPSAGYYRD
FLDHQWLYETWSPWLINKKLTLPEGTVGVLGGMFAVWNDKCGNGISEQDVHVRSFPALQV
LAEKMWKGSNCQVSFEQFEDLCRQMPEAPGVNLLGRIPSGVCQTASGEVQLTPAGEVCVL
SGTDSISTVLQEVGYPYAVSFKICPDENAPNSSILFKGPHSVVYANWENKGCLAFSRDGY
TFVFHSYHLPEGVWSDIRIEGDYKGTSLYVNGKLQERLEGRTKKVYCQQYKRMEYMEYQE
TLIFPLQQIGDGLNGFKGKIKNVVCKQF

Enzyme Prediction     

No EC number prediction in MGYG000003681_03130.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06564	GH20_DspB_LnbB-like	2.10e-48	1	128	198	326	Glycosyl hydrolase family 20 (GH20) catalytic domain of dispersin B (DspB), lacto-N-biosidase (LnbB) and related proteins. Dispersin B is a soluble beta-N-acetylglucosamidase found in bacteria that hydrolyzes the beta-1,6-linkages of PGA (poly-beta-(1,6)-N-acetylglucosamine), a major component of the extracellular polysaccharide matrix. Lacto-N-biosidase hydrolyzes lacto-N-biose (LNB) type I oligosaccharides at the nonreducing terminus to produce lacto-N-biose as part of the GNB/LNB (galacto-N-biose/lacto-N-biose I) degradation pathway. The lacto-N-biosidase from Bifidobacterium bifidum has this GH20 domain, a carbohydrate binding module 32, and a bacterial immunoglobulin-like domain 2, as well as a YSIRK signal peptide and a G5 membrane anchor at the N and C termini, respectively. The GH20 hexosaminidases are thought to act via a catalytic mechanism in which the catalytic nucleophile is not provided by solvent or the enzyme, but by the substrate itself.
cd02742	GH20_hexosaminidase	9.95e-08	7	127	190	303	Beta-N-acetylhexosaminidases of glycosyl hydrolase family 20 (GH20) catalyze the removal of beta-1,4-linked N-acetyl-D-hexosamine residues from the non-reducing ends of N-acetyl-beta-D-hexosaminides including N-acetylglucosides and N-acetylgalactosides. These enzymes are broadly distributed in microorganisms, plants and animals, and play roles in various key physiological and pathological processes. These processes include cell structural integrity, energy storage, cellular signaling, fertilization, pathogen defense, viral penetration, the development of carcinomas, inflammatory events and lysosomal storage disorders. The GH20 enzymes include the eukaryotic beta-N-acetylhexosaminidases A and B, the bacterial chitobiases, dispersin B, and lacto-N-biosidase. The GH20 hexosaminidases are thought to act via a catalytic mechanism in which the catalytic nucleophile is not provided by the solvent or the enzyme, but by the substrate itself.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBJ17917.1	4.76e-224	1	328	343	670
QQT77903.1	4.81e-180	1	327	342	660
QRP56853.1	4.81e-180	1	327	342	660
ASM65558.1	4.81e-180	1	327	342	660
QUU07476.1	4.81e-180	1	327	342	660

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6JQF_A	1.04e-30	1	320	419	726	Crystallizationanalysis of a beta-N-acetylhexosaminidase (Am2136) from Akkermansia muciniphila [Akkermansia muciniphila ATCC BAA-835]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B2UPR7	1.28e-30	1	320	441	748	Beta-hexosaminidase Amuc_2136 OS=Akkermansia muciniphila (strain ATCC BAA-835 / DSM 22959 / JCM 33894 / BCRC 81048 / CCUG 64013 / CIP 107961 / Muc) OX=349741 GN=Amuc_2136 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000055	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003681_03130.