CAZyme Information: MGYG000003681_01270

Basic Information

• Species: Bacteroides stercoris
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides stercoris
• CAZyme ID: MGYG000003681_01270
• CAZy Family: GH3
• CAZyme Description: Beta-glucosidase BoGH3B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
804		88870.14	5.9031

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003681	3833391	Isolate	China	Asia

• Gene Location: Start: 117467; End: 119881 Strand: +

Full Sequence      

MKHKLIICISALCLGLAGNVQAQNKKMYRNGWIDFNKNGVKDIYEDPSQPVEKRVADLLS
QMSVEEKTCQLATLYGYGRVLKDSLPVAGWKNEIWKDGIANIDEMLNGVGKKSAQVPGLL
YPFSNHAEAVNTVQRWFVEETRLGIPVDFTNEGIHGLNHTKATPLPAPIAIGSTWNKELV
RRAGVIAGQEAKALGYTNVYAPILDIVRDPRWGRTLECYGEEPYLIAALGTEMVNGIQSQ
GVAATLKHYAVYSVPKGGRDGNCRTDPHVAPRELHELFLYPFKKVIQNSHPMGVMSSYND
WDGVPVSASYYFLTELLREEYGFDGYVVSDSEAVEFVESKHHVADTYDEAVRQVLEAGLN
VRTHFTPPSDFILPIRRLLEEKKISMAVIDKRVSEVLRVKFRLGLFDQPYVADTKAADRV
GGADRNMDFVKQMQQQALVLLKNENNILPLDKRQIKKVLVTGPLADEDNFMTSRYGPNGL
ETVTVLAGLRNYLKGIAEVDYAKGCDIVDAGWPATEILPAPMSEQEKQGIAEAVAKAGES
DVIIAVLGEDEYRTGESRSRTSLDLPGRQQQLLEALHATGKPVILVLINGQPLTVNWANA
YIPAILESWFPGCQGGTVIAETLFGEHNPGGKLTVTFPKSVGQIELNFPFKPGSHGAQPH
SGPNGSGATRVIGELYPFGFGLSYTTFAYSDLEVSPLQQHNTQGEYTIKVNVTNTGKRAG
DEVVQLYVRDKVSSVITYDSQLRGFERVSLQPGETRQVTFSLKPEDLQILDRNMNWTVEP
GEFEVMIGASSQDIRLKKTITALP

Enzyme Prediction     

No EC number prediction in MGYG000003681_01270.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	139	361	6.5e-66	0.9722222222222222

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	0.0	47	795	30	758	beta-glucosidase BglX.
PLN03080	PLN03080	1.74e-86	142	764	78	744	Probable beta-xylosidase; Provisional
COG1472	BglX	9.61e-82	115	467	29	366	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam01915	Glyco_hydro_3_C	5.91e-67	438	684	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
pfam00933	Glyco_hydro_3	7.16e-61	115	399	31	316	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCI63350.1	0.0	1	804	1	804
QBN20400.1	0.0	1	804	1	810
AOW08795.1	0.0	9	804	11	805
ALJ60238.1	0.0	3	797	6	797
CDF78704.1	0.0	1	803	1	801

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XXL_A	5.65e-132	49	795	8	745	Crystalstructure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXL_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXM_A Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482],5XXM_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482]
5XXN_A	3.09e-131	49	795	8	745	CrystalStructure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXN_B Crystal Structure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXO_A Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482],5XXO_B Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482]
5TF0_A	7.81e-129	49	795	7	744	CrystalStructure of Glycosil Hydrolase Family 3 N-Terminal Domain Protein from Bacteroides intestinalis [Bacteroides intestinalis DSM 17393],5TF0_B Crystal Structure of Glycosil Hydrolase Family 3 N-Terminal Domain Protein from Bacteroides intestinalis [Bacteroides intestinalis DSM 17393]
5Z87_A	6.15e-126	38	795	30	778	ChainA, EmGH1 [Aurantiacibacter marinus],5Z87_B Chain B, EmGH1 [Aurantiacibacter marinus]
5YOT_A	4.18e-124	41	795	4	749	Isoprimeverose-producingenzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YOT_B Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YQS_A Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YQS_B Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KMH0	1.32e-141	142	797	62	716	Beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22130 PE=1 SV=1
P33363	4.21e-124	55	795	38	758	Periplasmic beta-glucosidase OS=Escherichia coli (strain K12) OX=83333 GN=bglX PE=3 SV=2
Q56078	2.45e-122	55	795	38	758	Periplasmic beta-glucosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bglX PE=3 SV=2
T2KMH9	5.24e-117	44	795	29	748	Putative beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22230 PE=2 SV=1
A7LXU3	9.36e-107	47	799	30	773	Beta-glucosidase BoGH3B OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02659 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000271	0.998989	0.000171	0.000181	0.000177	0.000158

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003681_01270.