CAZyme Information: MGYG000003681_00207

Basic Information

• Species: Bacteroides stercoris
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides stercoris
• CAZyme ID: MGYG000003681_00207
• CAZy Family: GH28
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
532	MGYG000003681_1|CGC5	58240.56	6.7122

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003681	3833391	Isolate	China	Asia

• Gene Location: Start: 252247; End: 253845 Strand: +

Full Sequence      

MNTLLKKLFTLTTFSLALLPAQNAVHAQCKNSIDENIYKELPFNMPKVEQPSFPDYTVSI
LQFGAKSDGTTLNTKAINDAIKAVNAKGGGKVVIPEGLWLTGPIELLSNVNLHTEKNALV
VFTDDFNAYPILETSFEGLNTRRCQSPISARNAENIAITGYGVFDGSGDSWRPVKKSKLT
AGQWDALVKSGGVVDKSIWYPTAGSLKGALACKNFNNPEGIETDEEWNEIRPWLRPVLLN
IVKSKRVLLEGVTFKNSPSWCLHPLSCEHITINQVKVFNPWYSQNGDALDLESCKNALII
NNIFDAGDDAICIKSGKDEDGRKRGEPCQNVIVKNNTVLHGHGGFVVGSEMSGGVKNIYV
TDCTFLGTDVGLRFKSTRGRGGVVEGIYIHNIHMIDIPHEALLFDLFYGGKAAGEETEED
LKGRMKTAVPQVTVETPSFRDIHISNIICKGSGRAMFFNGLPEMPIRNVTVKDVIINDAK
EGVVISQAEGITLENIRIETKGHTLDVKNAKNLKVDGKVYSAIGAEGKMLDF

Enzyme Prediction     

No EC number prediction in MGYG000003681_00207.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH28	84	495	1.8e-83	0.9569230769230769

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG5434	Pgu1	2.34e-86	53	394	78	395	Polygalacturonase [Carbohydrate transport and metabolism].
pfam00295	Glyco_hydro_28	7.90e-18	236	408	85	250	Glycosyl hydrolases family 28. Glycosyl hydrolase family 28 includes polygalacturonase EC:3.2.1.15 as well as rhamnogalacturonase A(RGase A), EC:3.2.1.-. These enzymes are important in cell wall metabolism.
PLN02218	PLN02218	1.34e-16	57	520	67	427	polygalacturonase ADPG
PLN03010	PLN03010	8.07e-14	59	419	48	331	polygalacturonase
PLN03003	PLN03003	1.03e-13	58	482	24	363	Probable polygalacturonase At3g15720

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT45779.1	0.0	1	532	1	532
QRQ48628.1	0.0	1	532	1	532
AVM53658.1	0.0	1	532	1	532
AVM57477.1	0.0	1	532	1	532
QDO69196.1	0.0	1	526	1	528

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3JUR_A	4.10e-71	48	496	18	429	Thecrystal structure of a hyperthermoactive Exopolygalacturonase from Thermotoga maritima [Thermotoga maritima],3JUR_B The crystal structure of a hyperthermoactive Exopolygalacturonase from Thermotoga maritima [Thermotoga maritima],3JUR_C The crystal structure of a hyperthermoactive Exopolygalacturonase from Thermotoga maritima [Thermotoga maritima],3JUR_D The crystal structure of a hyperthermoactive Exopolygalacturonase from Thermotoga maritima [Thermotoga maritima]
5OLP_A	1.25e-64	38	501	21	451	Galacturonidase[Bacteroides thetaiotaomicron VPI-5482],5OLP_B Galacturonidase [Bacteroides thetaiotaomicron VPI-5482]
2UVE_A	1.62e-32	46	518	145	604	Structureof Yersinia enterocolitica Family 28 Exopolygalacturonase [Yersinia enterocolitica],2UVE_B Structure of Yersinia enterocolitica Family 28 Exopolygalacturonase [Yersinia enterocolitica],2UVF_A Structure of Yersinia enterocolitica Family 28 Exopolygalacturonase in Complex with Digalaturonic Acid [Yersinia enterocolitica],2UVF_B Structure of Yersinia enterocolitica Family 28 Exopolygalacturonase in Complex with Digalaturonic Acid [Yersinia enterocolitica]
1BHE_A	3.32e-17	48	411	6	317	ChainA, POLYGALACTURONASE [Pectobacterium carotovorum]
4MXN_A	2.86e-14	55	188	21	143	Crystalstructure of a putative glycosyl hydrolase (PARMER_00599) from Parabacteroides merdae ATCC 43184 at 1.95 A resolution [Parabacteroides merdae ATCC 43184],4MXN_B Crystal structure of a putative glycosyl hydrolase (PARMER_00599) from Parabacteroides merdae ATCC 43184 at 1.95 A resolution [Parabacteroides merdae ATCC 43184],4MXN_C Crystal structure of a putative glycosyl hydrolase (PARMER_00599) from Parabacteroides merdae ATCC 43184 at 1.95 A resolution [Parabacteroides merdae ATCC 43184],4MXN_D Crystal structure of a putative glycosyl hydrolase (PARMER_00599) from Parabacteroides merdae ATCC 43184 at 1.95 A resolution [Parabacteroides merdae ATCC 43184]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A7PZL3	3.54e-39	56	477	61	425	Probable polygalacturonase OS=Vitis vinifera OX=29760 GN=GSVIVT00026920001 PE=1 SV=1
P15922	1.49e-36	25	518	128	598	Exo-poly-alpha-D-galacturonosidase OS=Dickeya chrysanthemi OX=556 GN=pehX PE=1 SV=1
P27644	2.52e-28	239	465	25	249	Polygalacturonase OS=Rhizobium radiobacter OX=358 GN=pgl PE=2 SV=1
P18192	6.76e-18	66	411	45	343	Endo-polygalacturonase OS=Pectobacterium carotovorum subsp. carotovorum OX=555 GN=peh PE=3 SV=1
Q949Z1	6.10e-17	60	408	82	373	Polygalacturonase At1g48100 OS=Arabidopsis thaliana OX=3702 GN=At1g48100 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000260	0.999051	0.000186	0.000164	0.000148	0.000136

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003681_00207.