CAZyme Information: MGYG000003678_01134

Basic Information

• Species: CAG-95 sp900553305
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; CAG-95; CAG-95 sp900553305
• CAZyme ID: MGYG000003678_01134
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
709		80938.13	5.0336

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003678	2408138	MAG	United Republic of Tanzania	Africa

• Gene Location: Start: 3777; End: 5906 Strand: -

Full Sequence      

MKNAGKDAERSTECISYQVFCKKQPDSTKSPIMTLLSMKAGQFPELQNQIKNGTLEEDVL
LLNFQDGEYSKLAIPMITEAFLELLPALVYGDEDVIVAGKRQNPWLKPDWSPDTFLSCFY
FGAFVAVPTAKIAEFLQKRSVLEGAEGEEKADLFADGWPKSELQQGKQEDQVLYELLADY
LRENGAFTGWKTADHVVVHIPQVLMHTEVSSYERWKNLHLTADITADIQVPTVSVIIPSK
DHPDILFRCLDSFVDKTSGLGTKVKTEFIIVDNGSSEENKNRIEQKLQKISNTRYIYKEL
PFNFSYMCNWGAKEAQGDYLLFLNDDMEIVDADWLILLMEKAVLPYVGAVGAKLLYPDTD
IIQHAGITNLRVGPAHKLQFAHDKEDHYFGQNRGVHDMLGVTGACLLVRKTLFEKVGGFD
ETLAVAFNDVDLCYKIYEEGYYNVVRNDLFLFHHESLSRGKDGESEEKQLRLLREKDYLY
EKHQDLYGKDPFYHPYLTTDMLETEYTPAFRYQVDLSMPWAKVKECTREVLAAREDECLV
IGMECAMDIYKWKYGVSPEKRKTKNLDLDKEDYSKKEKDHCNDSSNDSRDQGYYFQGYSF
VIGSDNACYKKELLLRRIADGNQQMLGNSVGKDEKMPQPVIYSISIEKKCREDIKANLKD
QVNVDLTGYAAKLKPGAVPAGKYQFGMLAKDACSRVKLVNWSSWTIEIL

Enzyme Prediction     

No EC number prediction in MGYG000003678_01134.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	234	416	3.3e-17	0.9882352941176471

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04186	GT_2_like_c	4.49e-33	235	455	1	166	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
COG1216	GT2	3.07e-26	231	489	3	256	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
cd00761	Glyco_tranf_GTA_type	2.54e-16	235	441	1	152	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.
pfam00535	Glycos_transf_2	4.94e-16	234	413	1	164	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
COG1215	BcsA	2.20e-12	226	441	49	252	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOZ95571.1	5.28e-147	67	701	97	694
ADL33298.1	1.69e-145	67	701	97	695
QNM02107.1	2.07e-114	88	700	83	659
QUF73846.1	2.07e-87	89	518	815	1240
ABR36854.1	2.07e-87	89	518	815	1240

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q50864	1.04e-41	87	498	433	832	O-antigen biosynthesis protein RfbC OS=Myxococcus xanthus OX=34 GN=rfbC PE=4 SV=1
P55465	1.22e-39	88	500	481	891	Uncharacterized protein y4gI OS=Sinorhizobium fredii (strain NBRC 101917 / NGR234) OX=394 GN=NGR_a03550 PE=4 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000055	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003678_01134.