CAZyme Information: MGYG000003676_00917

Basic Information

• Species: Fusicatenibacter sp900772675
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Fusicatenibacter; Fusicatenibacter sp900772675
• CAZyme ID: MGYG000003676_00917
• CAZy Family: GH39
• CAZyme Description: HTH-type transcriptional activator RhaS

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
832	MGYG000003676_188|CGC1	96698.33	5.8129

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003676	1891122	MAG	United Republic of Tanzania	Africa

• Gene Location: Start: 360; End: 2858 Strand: -

Full Sequence      

MERDNRDEDMMLKGTKQEMPGFRFRLLRPEKKRELWNPDFELLFLLRGSGRVSYEDGEVH
NLPVGSVFAINRFQICDLDLDEDGLALSLCISAETIAAFHIKLLKCEVKCQSFFYMENQQ
EKFDLIRRDMARIFLEMYKNNEEQPVYMKSRVTALLEDLLSYFTSEKKVEQGRSGRERLQ
RASDYILQHYREEITLEDLADHLYLSRAYISRSFPRYFGVSFLEYVTQVRLAHAVQEMHS
GATLTEISYRNGFVNETAMIRAFRKYRGMTPSEYRKQMKHTAEQSEKKGKEREEAAGDHD
IFQSLLQYAAVTEQGIETTNESAVSVTVAVNGRKPRVAGHWKRVINAGYAASVLNREVQD
ELEQLVQELGYELIRVKGILDDDMCVLRRNMWGEIQSCWNYIDEVIDFILSTGAKPLLEF
GHMPLLLAKTDPGRTLRPALSSLPRDLAEWRMLIKNLMEHLKERYGINQMRRWIFNPWIS
GDAIMSDEGDAFFETWKASYDEMKRVSPDLVTCLSFGLGPEEHLKAFIETMKEKECVPEI
FAFRSFGTVLYGEEEEKMNLIQNNESANMIVSRDPDFLRNRGEKVKGLLQKAGLGALPVL
VDECSSNIWQRDLCNDTCYKAAWLFKNFLENEEALQGIAYFSVNDRLDEIFPARETYHGG
FGLFTMNGIPKAVCTALRLLGRMGSRLVKRGDGYFISTEPEKNQSQIYLYNYVHYDMLYR
YRHAVNISRTDRYRVFNMGEIRTFSVKLTGLEPGKYCLRLYKVTKEHGSSYDAWVRMGAP
ERMNRMERAMLCHSADPEYRVWEQETDPEGSLTVQERLEPHETALIEVEQIL

Enzyme Prediction     

No EC number prediction in MGYG000003676_00917.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH39	339	783	6e-73	0.9814385150812065

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01229	Glyco_hydro_39	2.01e-37	341	828	18	487	Glycosyl hydrolases family 39.
COG2207	AraC	9.43e-31	159	282	2	126	AraC-type DNA-binding domain and AraC-containing proteins [Transcription].
smart00342	HTH_ARAC	3.50e-25	193	275	1	84	helix_turn_helix, arabinose operon control protein.
COG4753	YesN	2.16e-23	170	279	365	475	Two-component response regulator, YesN/AraC family, consists of REC and AraC-type DNA-binding domains [Signal transduction mechanisms, Transcription].
pfam12833	HTH_18	1.59e-21	199	277	1	81	Helix-turn-helix domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIQ24049.1	1.07e-179	22	826	11	815
AYA77562.1	9.35e-123	36	828	30	828
AIQ37108.1	5.14e-113	36	828	30	824
AIQ21948.1	3.81e-112	22	831	16	844
QBE96237.1	2.16e-111	27	826	4	813

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2BFG_A	6.08e-41	326	831	4	483	crystalstructure of beta-xylosidase (fam GH39) in complex with dinitrophenyl-beta-xyloside and covalently bound xyloside [Geobacillus stearothermophilus],2BFG_B crystal structure of beta-xylosidase (fam GH39) in complex with dinitrophenyl-beta-xyloside and covalently bound xyloside [Geobacillus stearothermophilus],2BFG_C crystal structure of beta-xylosidase (fam GH39) in complex with dinitrophenyl-beta-xyloside and covalently bound xyloside [Geobacillus stearothermophilus],2BFG_D crystal structure of beta-xylosidase (fam GH39) in complex with dinitrophenyl-beta-xyloside and covalently bound xyloside [Geobacillus stearothermophilus],2BFG_E crystal structure of beta-xylosidase (fam GH39) in complex with dinitrophenyl-beta-xyloside and covalently bound xyloside [Geobacillus stearothermophilus],2BFG_F crystal structure of beta-xylosidase (fam GH39) in complex with dinitrophenyl-beta-xyloside and covalently bound xyloside [Geobacillus stearothermophilus],2BFG_G crystal structure of beta-xylosidase (fam GH39) in complex with dinitrophenyl-beta-xyloside and covalently bound xyloside [Geobacillus stearothermophilus],2BFG_H crystal structure of beta-xylosidase (fam GH39) in complex with dinitrophenyl-beta-xyloside and covalently bound xyloside [Geobacillus stearothermophilus]
2BS9_A	8.23e-41	326	831	4	483	Nativecrystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus],2BS9_B Native crystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus],2BS9_C Native crystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus],2BS9_D Native crystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus],2BS9_E Native crystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus],2BS9_F Native crystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus],2BS9_G Native crystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus],2BS9_H Native crystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus]
1W91_A	1.50e-40	325	831	3	483	crystalstructure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct],1W91_B crystal structure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct],1W91_C crystal structure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct],1W91_D crystal structure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct],1W91_E crystal structure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct],1W91_F crystal structure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct],1W91_G crystal structure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct],1W91_H crystal structure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct]
4M29_A	9.28e-36	345	831	30	499	Structureof a GH39 Beta-xylosidase from Caulobacter crescentus [Caulobacter vibrioides CB15]
4EKJ_A	1.25e-35	345	831	30	499	ChainA, Beta-xylosidase [Caulobacter vibrioides]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9ZFM2	5.10e-39	326	831	4	484	Beta-xylosidase OS=Geobacillus stearothermophilus OX=1422 GN=xynB PE=1 SV=1
P23552	1.89e-34	324	796	7	453	Beta-xylosidase OS=Caldicellulosiruptor saccharolyticus OX=44001 GN=xynB PE=3 SV=1
O30360	2.20e-29	336	828	13	479	Beta-xylosidase OS=Thermoanaerobacterium saccharolyticum (strain DSM 8691 / JW/SL-YS485) OX=1094508 GN=xynB PE=3 SV=1
P36906	1.76e-27	336	798	13	450	Beta-xylosidase OS=Thermoanaerobacterium saccharolyticum OX=28896 GN=xynB PE=1 SV=1
Q6GD21	9.09e-19	38	774	15	687	Uncharacterized HTH-type transcriptional regulator SAS0078 OS=Staphylococcus aureus (strain MSSA476) OX=282459 GN=SAS0078 PE=4 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000046	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003676_00917.