CAZyme Information: MGYG000003676_00776

Basic Information

• Species: Fusicatenibacter sp900772675
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Fusicatenibacter; Fusicatenibacter sp900772675
• CAZyme ID: MGYG000003676_00776
• CAZy Family: GH146
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
297	MGYG000003676_157|CGC1	33580.02	5.3872

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003676	1891122	MAG	United Republic of Tanzania	Africa

• Gene Location: Start: 3048; End: 3941 Strand: -

Full Sequence      

MIIGGTVATGVLTFNGIINVLTTATFLIPIAFLYKLFTNKKIGGTGEGEMFHGADEIGRL
LSKNTAESCASYNMLKLTKELFSYQPDSRYMDYYERTMFNHIASSCDHAPTGASTYFMPL
APGFRKEFDDENSCCHGTGLENHFKYAERIYFQNDKAVYVNLFVPSALEKEDFKIIQEER
EDAPGEVTLKVQGSRAVTLKVRVPYWCQGSYQIWINGAEQSVETSSDGYLTLNADWSKET
TVEIHFTCHYTLERTPDVRDIASLLYGPYVLAALTEEKDYLHLPRRLPGLCQNSRQI

Enzyme Prediction     

No EC number prediction in MGYG000003676_00776.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH146	41	272	1e-80	0.4711729622266402

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07944	Glyco_hydro_127	6.98e-64	32	272	253	503	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
COG3533	COG3533	2.77e-47	32	288	255	520	Uncharacterized conserved protein, DUF1680 family [Function unknown].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AWY98728.1	2.61e-108	42	283	472	711
QNM13425.1	2.41e-89	42	296	469	722
QOS77131.1	2.39e-88	42	290	472	723
ASR48105.1	6.96e-84	42	297	470	726
ASA23792.1	2.84e-82	42	297	470	726

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6YQH_AAA	7.19e-44	42	296	311	586	ChainAAA, Acetyl-CoA carboxylase, biotin carboxylase [Bacteroides thetaiotaomicron VPI-5482]
5OPJ_A	2.24e-42	42	296	311	586	Beta-L-arabinofuranosidase[Bacteroides thetaiotaomicron]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.997688	0.002196	0.000082	0.000011	0.000009	0.000045

TMHMM  Annotations     

start	end
12	34