CAZyme Information: MGYG000003675_00361

Basic Information

• Species: Faecalibacterium sp900551435
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; Faecalibacterium; Faecalibacterium sp900551435
• CAZyme ID: MGYG000003675_00361
• CAZy Family: GH3
• CAZyme Description: Thermostable beta-glucosidase B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
805	MGYG000003675_40|CGC1	86293.47	5.3855

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003675	2696714	MAG	Peru	South America

• Gene Location: Start: 4444; End: 6861 Strand: -

Full Sequence      

MKHADIIQTLNLEQKCALLSGGTVFDTRALPGKGIPSITLSDGPNGVRKQAGAADHLGLN
PSVPATCFPTSATVANSWDPSLGEAVGEAMGEEAAAQEVSVLLGPGLNIKRSPLCGRNFE
YFSEDPYLAGKMAAGYVRGIQKNGISACPKHFAVNSQELRRMASDSIVDERTLRELYLTG
FEIVVKEAHPKTIMSSYNLINGTYANENAHLLQDILRKDWGFDGAVVTDWGGSNDHALGV
KNGSTLEMPFPGDDSVRELMKAVQSGKITEADVDARLDELLELVLDTKAAVEKAPRTFDA
DAHHALARKAAAQSIVLLKNEGNLLPLKKGEKVAVIGDFAKTPRYQGAGSSAVNSIKVDS
FLDCLTESGLANVGYAQGFERQGKANEQLKNEAVALAQNANVVLLCMGLDEIKESEGLDR
ADMKLAQNQIELLAAVAAVNPNVVVLLSAGSSLETPWLKDCKALVYGCLGGQAGAGALVE
VLTGAVCPSGKLAETWATGYDASPVKDNFAGKGRTVQYRESLYVGYRYFETAGKPVMFPF
GYGLSYTTFAYSDLKATADGVTLTVTNTGKCAGAEIVQLYVAKSDAKVFRPAQELKGFEK
VWLEAGESKTVTIPLDDKAFRYWNIATDSWEVEGGKYQLHVGASSADIRLTAEVTVLGSG
APDPYQSVELPHYMTGDVAHVPDAEFAALLGRPVPEDKIKIDRNMTLGELGHGRSPLGWI
VAAVLGFLLKQSIQRGKPDLNILFQYNMPLRALAKMTNGAISMGMVDGIVMEAQGFWIIG
LLRVIVEAVKNIVLNGQMENRLKNS

Enzyme Prediction     

EC	3.2.1.21	3.2.1.-	3.2.1.45

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	33	237	1.5e-64	0.9120370370370371

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	1.07e-83	66	657	118	765	beta-glucosidase BglX.
COG1472	BglX	1.61e-62	31	354	56	374	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
PLN03080	PLN03080	5.48e-53	6	616	56	743	Probable beta-xylosidase; Provisional
pfam01915	Glyco_hydro_3_C	1.09e-43	315	546	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
pfam00933	Glyco_hydro_3	1.13e-32	65	276	85	309	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBL01314.1	0.0	1	805	1	805
AXB27517.1	0.0	1	805	1	805
AXA81990.1	0.0	1	805	1	807
CBK98877.1	0.0	1	805	1	807
QOY61156.1	0.0	1	802	1	802

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7MS2_A	4.11e-201	6	656	8	668	ChainA, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	1.18e-187	7	664	9	671	CrystalStructure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
3AC0_A	4.84e-122	5	656	8	836	Crystalstructure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	8.40e-118	5	656	8	836	Crystalstructure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
2X40_A	1.53e-117	2	656	3	713	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P14002	2.25e-200	6	656	8	668	Thermostable beta-glucosidase B OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=bglB PE=1 SV=2
F6C6C1	1.96e-190	7	664	9	680	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium breve (strain ACS-071-V-Sch8b) OX=866777 GN=HMPREF9228_1477 PE=1 SV=1
E7CY69	1.10e-189	7	664	9	680	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium longum OX=216816 GN=apy PE=1 SV=1
A7LXS8	1.01e-128	5	651	48	740	Beta-glucosidase BoGH3A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02644 PE=1 SV=1
Q5BFG8	3.31e-123	5	654	13	836	Beta-glucosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglB PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.988475	0.011408	0.000093	0.000022	0.000011	0.000021

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003675_00361.